Recombinant Proteus mirabilis Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Proteus mirabilis MdtJ is a full-length, His-tagged protein expressed in Escherichia coli for biochemical studies. It belongs to the small multidrug resistance (SMR) family and is implicated in spermidine export, a process vital for counteracting intracellular spermidine toxicity . Key specifications include:

PropertyDetail
UniProt IDB4EVU5
Gene NamemdtJ
Protein Length146 amino acids
Expression SystemE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); -80°C preferred

The amino acid sequence includes residues critical for spermidine recognition, such as aromatic (Tyr, Trp) and acidic (Glu, Asp) residues, inferred from homologous E. coli MdtJI studies .

Spermidine Excretion Mechanism

  • Functional Assays: In E. coli, coexpression of MdtJ and MdtI reduced intracellular spermidine levels by ~50% under 2 mM spermidine stress, restoring cell viability .

  • Excretion Activity: Radiolabeled spermidine ([¹⁴C]spermidine) assays confirmed enhanced extracellular spermidine levels in cells expressing MdtJI .

Key Data

ParameterE. coli MdtJI (Reference)P. mirabilis MdtJ (Inferred)
Spermidine reduction50%Not directly tested
Critical residuesTyr, Trp, Glu, AspStructurally conserved
pH activity rangeNeutral (7.0)Likely similar

Applications in Research

  • Target for Antimicrobials: Inhibiting MdtJ could exacerbate spermidine toxicity in pathogens .

  • Mechanistic Studies: Used to dissect spermidine transport kinetics and structure-function relationships .

Limitations and Future Directions

Current data heavily rely on E. coli homologs. Direct functional validation in P. mirabilis is needed, particularly regarding its role in virulence and interaction with partner proteins like MdtI.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; PMI1158; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLVLAIICEVIGTLSMKYASVSGGYTGMIVMWLMIATSYIFLAIAVKKVALGVAY ALWEGIGIVIITTFSVLWFGESLSALKLGGLAMLIAGITLIKSGTKKSVVAKKTTDSVKN IAGKAKQVATVVKGVNKPISSNVKEA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links

KEGG: pmr:PMI1158

STRING: 529507.PMI1158

Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Spermidine export protein MdtJ and what is its function in bacterial cells?

MdtJ is a membrane protein belonging to the small multidrug resistance (SMR) family of transporters. In bacteria such as Escherichia coli, MdtJ forms a functional complex with MdtI (the MdtJI complex) that catalyzes the excretion of spermidine from cells at neutral pH. This export mechanism is crucial for maintaining polyamine homeostasis, which is essential for normal cell growth and function .

The MdtJI complex represents one of the first identified polyamine excretion systems that functions at neutral pH. Unlike other polyamine transporters such as PotE and CadB that function as uptake proteins at neutral pH and only export putrescine and cadaverine at acidic pH, the MdtJI complex specifically facilitates spermidine export under physiological conditions .

Why is studying MdtJ in Proteus mirabilis particularly important?

Proteus mirabilis is a significant urinary tract pathogen, particularly in patients with long-term catheterization. It is responsible for approximately 1-2% of UTIs in healthy adults and up to 45% of infections in catheterized patients . The bacteria's ability to cause persistent infections is linked to several virulence factors, including swarming motility, urease production, and biofilm formation .

Investigating polyamine transporters like MdtJ in P. mirabilis provides insights into:

  • Bacterial adaptation mechanisms during infection

  • Potential targets for novel antimicrobial therapies

  • The bacteria's ability to withstand environmental stresses

  • Possible connections between polyamine transport and antimicrobial resistance

What specific amino acid residues are critical for MdtJ function, and how can they be experimentally verified?

Research on E. coli MdtJ has identified several amino acid residues critical for its function in the MdtJI complex. These include Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82 in MdtJ . For complementary functioning, Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81 in MdtI are also essential.

To experimentally verify the importance of these residues in P. mirabilis MdtJ:

A systematic approach would involve creating a panel of mutants and measuring their relative transport activities:

MutationRelative Spermidine Export Activity (%)Cell Viability (%)
Wild-type100100
Y4A??
W5A??
E15A??
Y45A??
Y61A??
E82A??

How does the MdtJI complex differ between E. coli and P. mirabilis, and what are the functional implications?

While the MdtJI complex has been well-characterized in E. coli, its specific properties in P. mirabilis require further investigation. Researchers should consider:

  • Sequence homology analysis: Compare the amino acid sequences of MdtJ and MdtI between E. coli and P. mirabilis to identify conserved and divergent regions

  • Expression patterns: Determine if mdtJI expression in P. mirabilis is also induced by spermidine as observed in E. coli

  • Substrate specificity: Test whether the P. mirabilis MdtJI complex has the same substrate specificity for spermidine or if it can transport other polyamines

  • Role in virulence: Investigate whether MdtJI contributes to P. mirabilis pathogenicity, particularly in urinary tract infections

Functional implications may relate to P. mirabilis' unique ability to form crystalline biofilms and cause persistent UTIs. The regulation of polyamine levels via MdtJ could potentially impact biofilm formation, swarming motility, or resistance to host defense mechanisms.

What is the relationship between MdtJ function and antimicrobial resistance in P. mirabilis?

P. mirabilis exhibits increasing antimicrobial resistance, particularly through extended-spectrum beta-lactamases (ESBLs) . The potential connection between polyamine transport systems like MdtJ and antimicrobial resistance mechanisms presents an intriguing research question.

Research approaches could include:

  • Comparative expression analysis: Measure mdtJ expression levels in antibiotic-resistant versus susceptible P. mirabilis strains

  • Gene knockout studies: Create mdtJ knockout mutants and assess changes in minimum inhibitory concentrations (MICs) for various antibiotics

  • Biofilm analysis: Examine whether MdtJ affects biofilm formation, which can contribute to antibiotic tolerance

  • Combination therapy testing: Investigate whether inhibiting MdtJ could enhance the efficacy of existing antibiotics

Potential mechanisms linking MdtJ to resistance might include:

  • Cross-talk between efflux systems

  • Influence on membrane permeability

  • Effects on bacterial stress responses

  • Role in biofilm development and maintenance

What are the optimal conditions for expressing and purifying recombinant P. mirabilis MdtJ protein?

Based on established protocols for recombinant MdtJ proteins from other bacterial species, the following methodological approach is recommended:

  • Expression system: An E. coli expression system is typically used for recombinant production of membrane proteins like MdtJ

  • Affinity tag: Incorporate an N-terminal 10xHis-tag for purification via immobilized metal affinity chromatography (IMAC)

  • Expression vector: Select a vector with an inducible promoter (such as T7) to control expression levels

  • Culture conditions:

    • Medium: Use nutrient-rich media like LB or 2xYT

    • Temperature: Lower temperatures (16-25°C) during induction may enhance proper folding

    • Induction: Use IPTG at concentrations of 0.1-0.5 mM

  • Membrane extraction: Utilize detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) for membrane protein solubilization

  • Purification steps:

    • IMAC using Ni-NTA or cobalt-based resins

    • Size exclusion chromatography to ensure homogeneity

    • Consider ion exchange chromatography as an additional purification step

  • Storage conditions: Store at -20°C/-80°C, avoiding repeated freeze-thaw cycles

How can researchers effectively measure the spermidine export activity of recombinant MdtJ?

To accurately assess the spermidine export activity of recombinant MdtJ (ideally as part of the MdtJI complex), researchers can employ the following methodological approaches:

  • Cell-based functional assays:

    • Transform a spermidine-sensitive strain (such as E. coli deficient in spermidine acetyltransferase) with the recombinant mdtJI genes

    • Measure cell viability in the presence of excess spermidine (e.g., 2-12 mM)

    • Compare growth rates between transformed and control cells

  • Direct measurement of spermidine export:

    • Load cells with radiolabeled [14C]spermidine

    • Monitor the appearance of radioactivity in the extracellular medium over time

    • Confirm spermidine identity through HPLC analysis of the extracellular fraction

  • Measurement of intracellular polyamine content:

    • Grow cells in the presence of exogenous spermidine

    • Extract and quantify intracellular polyamines using HPLC or LC-MS/MS

    • Compare polyamine profiles between MdtJI-expressing and control cells

The following table illustrates typical results from a spermidine export assay:

Time (min)Spermidine Export (% of total labeled spermidine)
00
10~10-15
20~20-30
30~35-45
40~50-60

What experimental design approaches are most effective for studying MdtJ function in vivo?

When investigating MdtJ function in vivo, researchers should consider robust experimental designs that control for potential confounding variables. Referencing Campbell and Stanley's experimental design principles , the following approaches are recommended:

How can understanding MdtJ function contribute to novel therapeutic strategies against P. mirabilis infections?

The exploration of MdtJ function can lead to several therapeutic strategies:

  • Direct inhibition approaches:

    • Small molecule inhibitors targeting the MdtJI complex could disrupt polyamine homeostasis

    • Peptide-based inhibitors designed to interfere with MdtJ-MdtI interaction

    • Antibody-based approaches to block the transport channel

  • Combination therapy strategies:

    • MdtJ inhibitors could potentially sensitize P. mirabilis to existing antibiotics

    • Disruption of polyamine transport might reduce biofilm formation, enhancing antibiotic efficacy in CAUTIs

  • Anti-virulence approaches:

    • If MdtJ contributes to virulence factor expression, its inhibition could attenuate pathogenicity

    • Targeting polyamine homeostasis might disrupt processes like swarming motility or urease activity

  • Vaccine development:

    • Extracellular epitopes of MdtJ could potentially serve as vaccine targets

    • Combination with other membrane protein antigens might enhance protective immunity

The development of these strategies requires a thorough understanding of:

  • The structure-function relationship of MdtJ

  • The role of MdtJ in P. mirabilis pathogenesis

  • Potential off-target effects on host polyamine transport systems

  • Mechanisms of resistance that might emerge against MdtJ inhibitors

What are the most significant experimental challenges when working with recombinant MdtJ, and how can they be addressed?

Working with transmembrane proteins like MdtJ presents several significant challenges:

  • Protein solubility and stability issues:

    • Challenge: Membrane proteins often aggregate or misfold during expression

    • Solution: Use specialized expression strains (e.g., C41/C43), optimize detergent selection, and consider fusion partners like MBP or SUMO to enhance solubility

  • Functional reconstitution:

    • Challenge: MdtJ requires MdtI for full functional activity

    • Solution: Co-express both proteins or reconstitute the complex in vitro using purified components

  • Assay development:

    • Challenge: Direct measurement of spermidine transport can be technically demanding

    • Solution: Develop high-throughput screening assays using fluorescent spermidine analogs or indirect readouts like cell viability

  • Structural studies:

    • Challenge: Obtaining structural information about membrane proteins is difficult

    • Solution: Consider techniques like cryo-EM or X-ray crystallography with lipidic cubic phase crystallization

  • Storage stability:

    • Challenge: Recombinant MdtJ may lose activity during storage

    • Solution: Store at -20°C/-80°C, use cryoprotectants like glycerol (5-50%), and avoid repeated freeze-thaw cycles

Each challenge requires optimization specific to the experimental goals and available resources.

How can researchers investigate potential interactions between MdtJ and other virulence factors in P. mirabilis?

P. mirabilis employs multiple virulence factors during infection, including urease, fimbriae, hemolysins, and biofilm formation capabilities . Investigating potential functional interactions between MdtJ and these virulence mechanisms requires an integrated approach:

  • Transcriptomic analysis:

    • RNA-seq comparing wild-type and mdtJ-knockout strains under various conditions

    • Identification of co-regulated genes through clustering analysis

    • Validation of key findings using qRT-PCR

  • Proteomic approaches:

    • Co-immunoprecipitation to identify direct protein interaction partners

    • Membrane protein complex isolation using mild detergents

    • Cross-linking mass spectrometry to capture transient interactions

  • Functional assays for virulence factors:

    • Urease activity measurement in mdtJ mutants

    • Biofilm formation quantification using crystal violet staining

    • Swarming motility assessment on appropriate agar plates

    • Hemolysin production evaluation

  • Microscopy techniques:

    • Immunofluorescence to co-localize MdtJ with other virulence factors

    • Electron microscopy to examine structural features (fimbriae, flagella)

    • Live-cell imaging to monitor dynamic processes

  • In vivo infection models:

    • Compare the virulence of wild-type and mdtJ-knockout strains

    • Assess tissue colonization, biofilm formation, and host response

    • Evaluate the efficacy of combination therapies targeting multiple virulence factors

This multifaceted approach can reveal whether polyamine homeostasis maintained by MdtJ influences the expression or activity of other virulence determinants, potentially identifying new intervention points for therapeutic development against P. mirabilis infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.