Recombinant Proteus mirabilis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; PMI1044; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
arnC
Target Protein Sequence
MSTFEKINKVSVVIPVYNEEESLPQLLERTIKSCKQLEQEYELILVDDGSSDNSAKMLEE AANIEDNHVIAIILNRNYGQHSAIMAGFNQADGDLVITLDADLQNPPEEIPRLVATAEEG YDVVGTRRRNRQDSWFRKTASKMINAMITKATGRSMGDYGCMLRAYRRHIIDAMLQCHER STFIPILANTFARRTIEIEVAHAEREYGDSKYSFLKLINLMYDLLTCLTTAPLRLLSVVG SVIAVAGFLLAVLLIVLRLIFGAIWAADGVFTLFAILFMFIGAQFVAMGLLGEYIGRIYN DVRARPRYFIQKVVGVKKPNKNQEED
Uniprot No.

Target Background

Function

This recombinant Proteus mirabilis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC) catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links

KEGG: pmr:PMI1044

STRING: 529507.PMI1044

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of arnC in Proteus mirabilis?

ArnC is a polyprenyl phosphate glycosyltransferase that catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose (L-Ara4FN) from a UDP-activated donor to undecaprenyl phosphate (UndP). This reaction represents a critical step in the modification of lipopolysaccharide (LPS), which contributes to antimicrobial resistance in gram-negative bacteria such as Proteus mirabilis. The modified LPS reduces the binding affinity of cationic antimicrobial peptides and certain antibiotics to the bacterial outer membrane, promoting bacterial survival under antibiotic selection pressure .

The enzyme belongs to the GT-C superfamily of glycosyltransferases and functions within a multi-enzyme pathway (the Arn pathway) that ultimately leads to the incorporation of L-Ara4FN into lipid A, reducing the net negative charge of the bacterial outer membrane. In P. mirabilis, this mechanism is particularly relevant given the organism's intrinsic resistance to colistin, nitrofurantoin, tigecycline, and tetracycline, as well as its increasing acquisition of extended-spectrum β-lactamase genes and other resistance determinants .

How does arnC structure relate to its catalytic function?

The structural basis of arnC's catalytic function has been elucidated through cryo-electron microscopy studies of the homologous enzyme in Salmonella enterica. The enzyme adopts a GT-A fold characterized by a Rossmann-like domain containing the catalytic site and features distinctive juxtamembrane (JM) helices that play a crucial role in substrate binding and recognition .

Methodologically, researchers studying arnC structure should consider:

  • The enzyme exhibits a clamshell-like motion upon binding of UDP, bringing the GT-A domain closer to the juxtamembrane helices of each protomer.

  • The lipid substrate (UndP) threads between the juxtamembrane helices to reach the catalytic GT-A domain.

  • Metal ion coordination (specifically Mn²⁺) enables higher affinity binding of the UDP portion of the donor substrate.

  • Two distinct coordination positions for UndP exist within the GT-A domain: a "standby" position (P1) and a "catalysis" position (P2) .

The structural organization of arnC directly facilitates its catalytic mechanism, where the first aspartate of the conserved DXD motif functions as a catalytic base to abstract a proton from UndP, activating it for nucleophilic attack on the C1 carbon of the L-Ara4FN sugar .

What techniques have proven most effective for structural determination of arnC?

Cryo-electron microscopy (cryo-EM) has emerged as the most effective technique for structural determination of arnC and related membrane-associated glycosyltransferases. When investigating arnC structure, researchers should consider the following methodological approaches:

  • Nanodisc Reconstitution: Embedding the protein in lipid nanodiscs maintains the native membrane environment while providing a more homogeneous sample for structural studies.

  • Comparative Resolution Analysis: Studies with arnC homologs have shown that at matched particle counts, datasets collected at 200 kV and 300 kV microscopes differed negligibly in resolution, suggesting that lower energy microscopes may be sufficient for initial structural characterization .

  • Conformational State Capture: To fully understand the enzyme mechanism, structures should be determined in multiple functional states (e.g., apo, UDP-bound, and ideally substrate-bound forms).

  • Resolution Enhancement Strategies: When resolution limits are encountered, consider:

    • Alternative reconstruction algorithms

    • Complex stabilization approaches

    • Physical improvements to grid preparation

    • Increasing particle counts to overcome B-factor limitations

For P. mirabilis arnC specifically, researchers should be aware that specimen-dependent limitations rather than instrumentation often impose practical limits to resolution via the B-factor. Comparative analysis with the S. enterica homolog can provide valuable structural insights until high-resolution structures of the P. mirabilis enzyme become available.

How can molecular dynamics simulations enhance understanding of arnC function?

Molecular dynamics (MD) simulations provide crucial insights into arnC function that complement static structural data. Researchers investigating arnC should consider both coarse-grained (CG) and atomistic simulation approaches:

  • Coarse-Grained Simulations: These are valuable for:

    • Tracking the pathway of UndP through the juxtamembrane helices

    • Identifying initial binding modes of the lipid substrate

    • Exploring longer timescale conformational changes with reduced computational cost

  • Atomistic Simulations: These provide higher resolution insights into:

    • Precise coordination of metal ions and substrates

    • Hydrogen bonding networks in the active site

    • Proton transfer mechanisms during catalysis

    • Conformational changes in key loops like the β7-JM2 loop, which rearranges upon substrate binding

When designing simulation studies, researchers should consider creating multiple models representing different catalytic states, such as:

  • State 1: UndP in the "standby" position with donor substrate

  • State 2: UndP in the "catalysis" position with donor substrate

  • Product state: Following glycosyl transfer

These simulations have revealed that the acceptor phosphate of UndP must be positioned in relative proximity to both the potential catalytic base (D100 in S. enterica arnC) and the anomeric carbon of the L-Ara4FN sugar for catalysis to occur effectively .

What challenges are commonly encountered in recombinant expression of P. mirabilis arnC?

Recombinant expression of membrane-associated glycosyltransferases like P. mirabilis arnC presents several challenges that researchers should anticipate and address methodologically:

  • Membrane Association: The juxtamembrane helices and hydrophobic regions of arnC can cause aggregation during expression. Consider:

    • Using specialized expression hosts optimized for membrane proteins

    • Including mild detergents in lysis and purification buffers

    • Employing fusion partners that enhance solubility (e.g., MBP, SUMO)

  • Protein Folding: Correct folding is critical for maintaining the spatial relationship between the GT-A domain and juxtamembrane helices. Strategies include:

    • Lower temperature induction (16-20°C)

    • Co-expression with molecular chaperones

    • Addition of osmolytes or stabilizing agents during expression

  • Metal Ion Incorporation: Given the importance of Mn²⁺ for substrate binding, consider:

    • Supplementing expression media with MnCl₂

    • Including appropriate concentrations of metal ions in purification buffers

    • Avoiding chelating agents that might strip essential metals

  • Activity Preservation: To maintain catalytic activity through purification:

    • Limit exposure to reducing agents that might disrupt essential disulfide bonds

    • Include stabilizing ligands (e.g., UDP) during purification

    • Consider nanodisc or liposome reconstitution for functional studies

When designing expression constructs, researchers should carefully consider the boundaries of the construct to ensure all functional elements are included while minimizing regions that might promote aggregation.

What are the optimal conditions for measuring arnC enzymatic activity?

Establishing reliable assays for arnC activity is essential for functional characterization. The following methodological considerations should guide researchers:

  • Substrate Preparation:

    • UDP-L-Ara4FN can be enzymatically synthesized using the ArnA and ArnB enzymes

    • UndP must be properly solubilized, typically in detergent micelles or synthetic membranes

  • Assay Conditions:

    • Buffer: Typically HEPES or Tris at pH 7.5-8.0

    • Metal cofactor: 1-5 mM MnCl₂ (optimal based on MST studies showing enhanced UDP binding in the presence of Mn²⁺)

    • Detergent: Non-ionic detergents at concentrations above CMC but below inhibitory levels

    • Temperature: 25-37°C depending on stability of the recombinant protein

  • Activity Detection Methods:

    • Radiolabeled substrate approach using ³H or ¹⁴C labeled UDP-L-Ara4FN

    • HPLC separation and quantification of reaction products

    • Coupled enzymatic assays monitoring UDP release

    • Mass spectrometry to directly detect the UndP-L-Ara4FN product

  • Data Analysis:

    • Determine kinetic parameters (Km, Vmax) for both substrates

    • Evaluate metal ion dependence by varying Mn²⁺ concentrations

    • Assess pH optima and temperature stability

For researchers investigating potential inhibitors, competitive assays against either UDP-L-Ara4FN or UndP can be developed using the above approaches with fixed concentrations of one substrate while varying the other.

How does arnC activity contribute to antimicrobial resistance profiles in P. mirabilis?

P. mirabilis strains are increasingly acquiring multidrug resistance (MDR) profiles, with arnC activity potentially contributing to this resistance through LPS modification. Researchers investigating this connection should consider:

  • Correlation Analysis: Studies should examine correlations between arnC expression levels and resistance to specific antibiotics, particularly those targeting the bacterial outer membrane.

  • Genetic Context: Analysis of MDR P. mirabilis isolates has revealed that:

    • 78.6% of clinical isolates carry at least 15 antimicrobial resistance genes

    • Mobile genetic elements including SXT/R391 Integrative and Conjugative Elements (ICEs) commonly carry resistance genes

    • Resistance islands like PmGRI1 may contain multiple resistance determinants

  • Co-occurrence Patterns: Research shows that virulence factors (including LPS modifications) often co-occur with antimicrobial resistance genes in P. mirabilis:

    • 73.33% of clinical isolates are classified as MDR

    • Strong biofilm-producers show significant correlation with MDR phenotypes

    • Virulence genes like zapA and ureC are harbored by all isolates, while others show variable distribution (rsbA 95%, ureA and flaA 93%, hpmA 91.7%, mrpA 73.3%)

  • Methodological Approach: When investigating the role of arnC in resistance:

    • Generate knockout or knockdown strains using appropriate genetic tools

    • Measure MICs against multiple antibiotic classes before and after modification

    • Combine with outer membrane permeability assays to directly link LPS modification to reduced uptake

Table 1: Distribution of resistance patterns and biofilm formation across age groups in P. mirabilis clinical isolates

How can arnC be targeted for antimicrobial development?

The structural and functional characterization of arnC presents opportunities for targeted antimicrobial development. Researchers pursuing this direction should consider these methodological approaches:

  • Rational Inhibitor Design:

    • Target the catalytic site with UDP or L-Ara4FN analogs

    • Design compounds that interfere with the "clamshell" conformational change

    • Develop molecules that block the UndP entry path through the juxtamembrane region

  • High-throughput Screening Strategies:

    • Develop fluorescence-based assays suitable for large compound libraries

    • Create cell-based reporter systems that indicate LPS modification

    • Implement counterscreens to ensure specificity for arnC versus other glycosyltransferases

  • Structure-Activity Relationship Studies:

    • Focus on the critical DXD motif and surrounding residues

    • Evaluate metal-chelating compounds that might disrupt Mn²⁺ coordination

    • Explore compounds that stabilize the inactive conformation of the enzyme

  • Combination Approaches:

    • Test arnC inhibitors in combination with existing antibiotics, particularly:

      • Polymyxins (normally resisted through LPS modification)

      • β-lactams (commonly resisted by MDR P. mirabilis)

      • Quinolones (resistance to which is increasing in P. mirabilis)

Researchers should note that targeting arnC might not only directly inhibit P. mirabilis growth but could also restore sensitivity to other antibiotics by preventing protective LPS modifications, making this approach particularly valuable for combination therapy strategies.

What are the critical differences between arnC homologs across bacterial species?

Understanding species-specific variations in arnC structure and function is essential for comprehensive characterization. Researchers should consider these methodological approaches to comparative analysis:

  • Sequence-Based Comparison:

    • Perform multiple sequence alignments focusing on:

      • The DXD catalytic motif region

      • Juxtamembrane helices

      • Substrate binding regions

    • Identify conserved vs. variable regions that might influence substrate specificity

  • Structural Comparison:

    • Generate homology models based on the S. enterica structure

    • Use molecular dynamics to investigate species-specific dynamics

    • Compare electrostatic surface potentials that might influence substrate recognition

  • Functional Assessment:

    • Perform cross-species complementation studies

    • Develop chimeric proteins to identify species-specific functional domains

    • Compare kinetic parameters across homologs under identical conditions

  • Evolutionary Analysis:

    • Construct phylogenetic trees of arnC homologs

    • Correlate sequence variations with known antibiotic resistance phenotypes

    • Identify evidence of horizontal gene transfer events involving arnC

While the catalytic mechanism involving UndP threading and the two-position model is likely conserved across species, researchers should be aware that subtle variations in substrate recognition and catalytic efficiency might exist, potentially contributing to species-specific resistance profiles .

How can changes in arnC expression or activity be accurately measured in response to environmental conditions?

Monitoring arnC expression and activity changes in response to environmental stimuli requires sophisticated methodological approaches:

  • Transcriptional Analysis:

    • qRT-PCR with carefully validated reference genes

    • RNA-seq to place arnC regulation in genome-wide context

    • Promoter-reporter fusions to visualize expression changes in real-time

  • Protein Level Quantification:

    • Western blotting with specific antibodies (may require generation of custom antibodies)

    • Targeted proteomics using MRM-MS (Multiple Reaction Monitoring-Mass Spectrometry)

    • ELISA-based approaches for high-throughput screening

  • Activity Assessment in Native Context:

    • Membrane isolation followed by in vitro activity assays

    • Mass spectrometry analysis of LPS modifications

    • Fluorescent D-amino acid (FDAA) incorporation to visualize cell wall/membrane alterations

  • Environmental Conditions to Test:

    • Antibiotic exposure (sub-MIC concentrations)

    • pH variation (particularly relevant for P. mirabilis which can raise urinary pH)

    • Biofilm vs. planktonic growth

    • Host-relevant conditions (urine, serum components)

When designing these experiments, researchers should consider the regulatory pathways that control arnC expression, including potential two-component systems that sense environmental changes and trigger adaptive responses in LPS modification.

What are the most promising approaches for studying the in vivo relevance of arnC in infection models?

Translating biochemical understanding of arnC to in vivo infection contexts requires specialized methodological approaches:

  • Animal Model Considerations:

    • Utilize established urinary tract infection (UTI) models given P. mirabilis' association with UTIs

    • Consider catheter-associated biofilm models to reflect clinical scenarios where P. mirabilis causes infections

    • Implement immune-compromised models to assess the role of arnC in evading host defenses

  • Genetic Manipulation Strategies:

    • Generate conditional knockdown strains to avoid growth defects in culture

    • Create point mutations in catalytic residues to specifically disrupt enzyme function

    • Develop reporter strains where arnC expression is linked to fluorescent markers

  • Analytical Approaches:

    • Perform comparative transcriptomics of wild-type vs. arnC-modified strains during infection

    • Use imaging mass spectrometry to visualize LPS modifications in situ

    • Implement competitive infection assays to quantify fitness effects of arnC modification

  • Host Response Assessment:

    • Measure antimicrobial peptide effectiveness against wild-type vs. arnC-modified strains

    • Evaluate neutrophil and macrophage interactions with modified strains

    • Assess inflammatory marker production in response to different LPS structures

These approaches will help establish the contribution of arnC to virulence and persistence in clinically relevant infection settings, potentially validating it as a therapeutic target.

How might structural knowledge of arnC inform broader understanding of bacterial glycosyltransferases?

The structural insights gained from arnC studies have implications for understanding other bacterial glycosyltransferases. Researchers exploring these connections should consider:

  • Comparative Structural Analysis:

    • Generate structure-based sequence alignments of diverse GT-C family enzymes

    • Identify conserved catalytic features versus substrate-specific elements

    • Develop classification schemes based on structural rather than sequence features

  • Mechanistic Investigations:

    • Test whether the "two-position" model for UndP binding applies to other polyprenyl-phosphate GTs

    • Investigate if the clamshell-like conformational change is a conserved feature

    • Explore the role of metal ions in different GT families

  • Structure-Function Relationships:

    • Perform systematic mutagenesis of conserved residues across multiple GTs

    • Develop chimeric enzymes to test domain portability between different GTs

    • Explore substrate promiscuity across related enzymes

  • Evolution of Glycosyltransferase Function:

    • Reconstruct ancestral GT sequences and characterize their activities

    • Identify structural adaptations associated with substrate specificity shifts

    • Map the emergence of antibiotic resistance-associated GTs in bacterial lineages

The proposed catalytic mechanism for arnC, involving UndP threading through juxtamembrane helices and the role of the DXD motif, likely operates similarly across the Pren-P GT family, providing a framework for understanding this entire class of enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.