Recombinant Proteus mirabilis UPF0208 membrane protein PMI1770 (PMI1770)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
PMI1770; UPF0208 membrane protein PMI1770
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
PMI1770
Target Protein Sequence
MNEPTVTPPGFFKKLRLGNEYLKTWPVEKQLAPVFPENRMIKATRFGIRYMPPIAIFTLT WQIALGGDLGPAITTALFACSLPMQGLWWLGKRAATPLPAVLLNWFYEIREKFEQAGIAL APVEKTPTYLSLAHLLKRAFKQLDRSFLDDV
Uniprot No.

Target Background

Database Links

KEGG: pmr:PMI1770

STRING: 529507.PMI1770

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0208 protein family and what is known about PMI1770?

The UPF0208 protein family represents a group of uncharacterized membrane proteins found across bacterial species. PMI1770 belongs to this family and is encoded in the P. mirabilis genome. While its specific function remains to be fully elucidated, it likely contains multiple transmembrane domains and plays a role in the membrane biology of P. mirabilis.

Comparative genomic analyses suggest conservation across related bacterial species, indicating potential functional importance. The protein's designation as "UPF" (Uncharacterized Protein Family) indicates that its specific biological role requires further investigation, making it an interesting target for researchers studying P. mirabilis membrane biology .

How does PMI1770 relate to the virulence mechanisms of P. mirabilis?

While the direct role of PMI1770 in virulence isn't fully characterized, P. mirabilis employs multiple membrane proteins in its pathogenicity mechanisms. Key virulence factors include:

Virulence FactorCellular LocationFunction in Pathogenicity
FimbriaeCell surfaceAdhesion to host tissues
UreaseCytoplasmic/SecretedUrea hydrolysis leading to stone formation
Hemolysins (HpmA)SecretedCytolytic activity against host cells
ZapA proteaseCell surface/SecretedDegradation of host proteins, contributes to prostatitis
SiderophoresMembrane/SecretedIron acquisition in host environment

PMI1770 may interact with these established virulence factors, potentially contributing to membrane integrity, protein trafficking, or bacterial stress responses. Research suggests that membrane proteins play critical roles in the complex pathogenic strategies of P. mirabilis, including its distinctive swarming behavior .

What expression systems are suitable for recombinant production of PMI1770?

Membrane proteins pose unique challenges for recombinant expression. For PMI1770, consider these systems:

Expression SystemAdvantagesLimitationsBest For
E. coli BL21(DE3)High yield, economical, simple protocolsMay form inclusion bodiesInitial expression trials
C41/C43 E. coli strainsDesigned for membrane proteinsLower yieldsToxic membrane proteins
Cell-free systemsAvoids toxicity issues, direct integration into lipidsExpensive, limited scaleDifficult-to-express proteins
Pichia pastorisPost-translational modifications, high densityLonger timeframeLarger-scale production

For optimal expression, use vectors containing solubility tags (MBP, SUMO) and optimize induction conditions (temperature, IPTG concentration). Initial test expressions can determine if PMI1770 requires specialized systems beyond standard E. coli .

What purification strategies work best for PMI1770?

Purification of membrane proteins requires strategies that maintain their native structure:

  • Membrane preparation via differential centrifugation

  • Solubilization screening with various detergents (DDM, LDAO, Triton X-100)

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for final polishing

Critical factors include detergent selection and concentration, salt conditions, and pH optimization. Proteomic studies of P. mirabilis outer membrane proteins have established effective isolation protocols that could be adapted for PMI1770 purification .

How do we assess the proper folding of recombinant PMI1770?

Confirming proper folding is crucial for functional studies:

Assessment MethodInformation ProvidedTechnical Complexity
Circular DichroismSecondary structure contentModerate
Intrinsic fluorescenceTertiary structure assessmentModerate
Thermal stability assaysProtein stabilityLow to Moderate
Limited proteolysisDomain organizationModerate
Size exclusion chromatographyOligomeric stateLow

Properly folded membrane proteins typically show resistance to proteolysis, good thermal stability, and homogeneous behavior on size exclusion columns. Comparison with native PMI1770 isolated from P. mirabilis membranes provides the gold standard for assessing recombinant protein quality .

How can we determine the function of uncharacterized membrane proteins like PMI1770?

Elucidating the function of uncharacterized membrane proteins requires a multi-faceted approach:

  • Genomic context analysis: Examine neighboring genes that may suggest functional relationships

  • Phenotypic characterization of knockout mutants: Generate PMI1770 deletion strains and assess:

    • Growth characteristics under various conditions

    • Swarming behavior modifications

    • Virulence in infection models

    • Antibiotic susceptibility changes

  • Transcriptomic analysis: Identify co-expressed genes during different growth phases

  • Protein-protein interaction studies: Identify binding partners using pull-down assays or bacterial two-hybrid systems

  • Structural characterization: Determine structure through crystallography or cryo-EM

P. mirabilis swarming involves complex cellular differentiation with distinct gene expression patterns. Investigating PMI1770 expression during this process could reveal functional insights .

What experimental approaches can resolve contradicting data about PMI1770 function?

When faced with contradictory data regarding membrane protein function:

  • Standardize experimental conditions across laboratories

  • Implement the following experimental design principles:

    • Use multiple complementary techniques

    • Include appropriate controls for each method

    • Vary experimental parameters systematically

    • Develop quantitative assays with statistical validation

Statistical ApproachApplicationBenefit
ANOVACompare multiple conditionsIdentifies significant differences between experimental groups
Multiple regressionAnalyze relationships between variablesDetermines which factors most strongly influence outcomes
Principal component analysisReduce data complexityIdentifies patterns in multidimensional datasets
Bayesian modelingIncorporate prior knowledgeProvides probabilistic assessment of conflicting hypotheses

Design experiments according to established statistical principles, as outlined in resources like "Design and Analysis of Experiments," ensuring proper replication, randomization, and blocking where appropriate .

How does PMI1770 expression change during the swarming process of P. mirabilis?

P. mirabilis displays a distinctive swarming behavior characterized by differentiation of vegetative cells into elongated, hyperflagellated swarm cells. To study PMI1770 expression during this process:

  • Isolate RNA/protein at different phases of the swarming cycle:

    • Vegetative cells

    • Early differentiation

    • Active swarming

    • Consolidation phase

  • Use quantitative RT-PCR to measure PMI1770 transcript levels

  • Implement reporter gene constructs (PMI1770-GFP) for spatial expression visualization

  • Compare expression with known swarming regulators

P. mirabilis swarming involves coordinated population movement with distinct gene expression patterns. The bacterium undergoes cyclical differentiation with elongated, hyperflagellated cells (20-80 μm) that coordinate their movements. Based on studies of other P. mirabilis membrane proteins, expression patterns during swarming could reveal important functional insights about PMI1770 .

What structural characterization approaches are suitable for PMI1770?

Membrane proteins present unique challenges for structural determination:

MethodResolutionSample RequirementsStrengths
X-ray crystallography1.5-3ÅCrystalsAtomic resolution
Cryo-EM2.5-4ÅPurified proteinNo crystals needed
NMRVariableIsotope-labeled proteinDynamic information
Molecular dynamicsTheoreticalHomology modelConformational insights

For PMI1770, a strategic approach might include:

  • Bioinformatic structure prediction using AlphaFold

  • Homology modeling based on structurally characterized UPF0208 family members

  • Limited proteolysis to identify stable domains

  • Detergent screening to identify conditions promoting stability

  • Crystallization trials or cryo-EM sample preparation

Critical for success is maintaining the protein in a membrane-mimetic environment using appropriate detergents or nanodiscs .

How can we design mutation studies to elucidate the functional domains of PMI1770?

Systematic mutational analysis provides powerful insights into protein function:

  • Sequence alignment of UPF0208 family members to identify conserved residues

  • Structure-guided mutagenesis targeting:

    • Predicted transmembrane regions

    • Conserved charged residues in membrane proteins

    • Putative functional motifs

  • Construction of mutation library using:

    • Alanine scanning of conserved regions

    • Domain swapping with homologous proteins

    • Truncation series to identify minimal functional units

Each mutant should be assessed for:

  • Membrane localization

  • Protein stability

  • Complementation of knockout phenotypes

  • Impact on swarming behavior

  • Effect on virulence in infection models

The unique swarming behavior of P. mirabilis provides a powerful phenotypic readout for functional studies, as mutations in membrane-related genes often affect the distinctive bull's-eye pattern formed during colony expansion .

What role might PMI1770 play in iron acquisition mechanisms?

Iron acquisition is critical for bacterial pathogenesis, and P. mirabilis employs several membrane proteins in this process:

  • Three putative iron receptors (IreA, PMI0842, PMI2596) are upregulated under iron-restricted conditions and during in vivo growth

  • Siderophores (iron-chelating metallophores) contribute to virulence strategies

To investigate PMI1770's potential role in iron acquisition:

  • Compare expression under iron-replete versus iron-restricted conditions

  • Assess growth of PMI1770 knockout strains under iron limitation

  • Examine interactions with known iron acquisition proteins

  • Measure siderophore production and utilization in mutant strains

Proteomic analysis of P. mirabilis outer membrane proteins has identified several iron receptors expressed under iron-restricted conditions, similar to those encountered during infection. PMI1770 could potentially interact with these established iron acquisition systems .

What approaches can identify the role of PMI1770 in antibiotic resistance?

P. mirabilis exhibits concerning antibiotic resistance, including extended-spectrum β-lactamases (ESBLs) and carbapenemases. To explore PMI1770's potential involvement:

  • Compare minimum inhibitory concentrations (MICs) between wild-type and PMI1770 knockout strains

  • Measure antibiotic accumulation in cells with altered PMI1770 expression

  • Examine PMI1770 expression in response to antibiotic exposure

  • Investigate potential interactions with known resistance determinants

Antibiotic ClassResistance MechanismPotential Membrane Protein Involvement
β-lactamsβ-lactamase production, altered permeabilityTransport across membrane
AminoglycosidesEfflux pumps, modifying enzymesMembrane potential maintenance
QuinolonesTarget mutations, efflux pumpsPermeability barriers
PolymyxinsLPS modificationsMembrane structure maintenance

Membrane proteins often contribute to intrinsic resistance by affecting cell permeability or participating in efflux systems. Understanding PMI1770's potential role could provide insights into P. mirabilis antibiotic resistance mechanisms .

How does PMI1770 interact with host factors during infection?

P. mirabilis interacts with host factors during infection, with membrane proteins playing key roles:

  • Proteomic studies have shown that plasminogen, a host protein, co-purifies with P. mirabilis outer membrane proteins from in vivo grown bacteria

  • This association may contribute to virulence, as seen in other bacterial pathogens

To investigate PMI1770-host interactions:

  • Conduct binding assays with purified host factors (plasminogen, complement components)

  • Perform infection studies with PMI1770 knockout strains

  • Utilize immunoprecipitation to identify host proteins that interact with PMI1770

  • Examine PMI1770 expression during different stages of infection

Understanding these interactions could reveal how PMI1770 contributes to P. mirabilis adaptation to the host environment during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.