Recombinant Proteus mirabilis UPF0442 protein PMI1443 (PMI1443)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
PMI1443; UPF0442 protein PMI1443
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Proteus mirabilis (strain HI4320)
Target Names
PMI1443
Target Protein Sequence
MGIINIILTLIEDMILAAIPAVGFAMVFNVPLRALKYCALLGAIGHGSRTVLMISGMNIE WASFCAAILVGCIGIQWSRWWLAHPKVFTVAAIIPMFPGINAYVAMISVVKLTQIGYSEE IFEALVTNFLKASFIVGALSIGLSLPGLWLYRKRPSV
Uniprot No.

Target Background

Database Links

KEGG: pmr:PMI1443

STRING: 529507.PMI1443

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteus mirabilis and why is it significant in microbiology research?

Proteus mirabilis is a gram-negative, facultatively anaerobic opportunistic pathogen that plays a significant role in various infections, most notably urinary tract infections (UTIs). The bacterium holds particular significance in microbiology research due to its unique swarming motility and its increasing antimicrobial resistance profile. P. mirabilis is characterized by its ability to colonize and form crystalline multidrug-resistant (MDR) biofilms, which represents a major factor in recurrent catheter-associated urinary tract infections (CAUTIs) .

The microorganism's public health significance has grown considerably as resistance rates have increased, with approximately 48% of P. mirabilis strains exhibiting antimicrobial resistance that complicates treatment protocols . Research on P. mirabilis contributes to our understanding of bacterial pathogenicity mechanisms, biofilm formation, and the development of novel therapeutic approaches to combat increasingly resistant bacterial strains.

This organism's ability to develop resistance through various mechanisms, including extended-spectrum beta-lactamase (ESBL) production, makes it an important model for studying horizontal gene transfer and antimicrobial resistance acquisition in gram-negative pathogens. Furthermore, its distinctive colonization patterns and virulence factors offer insights into bacterial adaptation and host-pathogen interactions.

What is the UPF0442 protein PMI1443 and what is known about its function?

The UPF0442 protein PMI1443 is a protein encoded by the PMI1443 gene in Proteus mirabilis strain HI4320. The "UPF" designation (Uncharacterized Protein Family) indicates that this protein belongs to a family whose function has not been fully characterized. While the specific function of PMI1443 remains incompletely understood, research suggests it may play a role in bacterial cellular processes.

The protein is classified as "partial" in recombinant form, indicating that only a portion of the full protein sequence is expressed in commercially available research products . This partial expression may be due to technical limitations or intentional design to focus on specific functional domains of interest. The recombinant version can be produced in various expression systems including E. coli, yeast, baculovirus, and mammalian cells, each potentially resulting in different post-translational modifications that might affect protein functionality .

Current research approaches to elucidate the function of UPF0442 protein PMI1443 include comparative genomics, structural analysis, and gene knockout studies. Preliminary data suggests possible roles in cell membrane integrity, stress response, or regulatory functions, though conclusive evidence remains limited. Understanding this protein's function could potentially reveal new targets for antimicrobial development or provide insights into P. mirabilis pathogenicity mechanisms.

What expression systems are available for producing recombinant PMI1443 protein?

Multiple expression systems are available for producing recombinant Proteus mirabilis UPF0442 protein PMI1443, each with distinct advantages and limitations that researchers should consider based on their specific experimental requirements. The selection of an appropriate expression system depends on factors including desired post-translational modifications, protein folding requirements, and intended downstream applications.

For applications requiring eukaryotic post-translational modifications, researchers can utilize yeast (product code: CSB-YP451791EYZ1), baculovirus (product code: CSB-BP451791EYZ1), or mammalian cell (product code: CSB-MP451791EYZ1) expression systems . The yeast system provides a balance between bacterial simplicity and eukaryotic modifications, while the baculovirus system delivers higher eukaryotic protein processing capabilities. The mammalian cell system, though more resource-intensive, offers the most authentic human-like modifications and folding environment.

Additionally, specialized versions such as the Avi-tag Biotinylated variant (product code: CSB-EP451791EYZ1-B) are available for applications requiring site-specific biotinylation . This variant utilizes E. coli biotin ligase (BirA) technology to create a covalent amide linkage between biotin and a specific lysine residue in the AviTag peptide, enabling oriented immobilization for applications such as protein interaction studies or immunoassays.

What purification methods are most effective for recombinant PMI1443 protein?

The purification of recombinant Proteus mirabilis UPF0442 protein PMI1443 typically requires a strategic multi-step approach to achieve high purity while maintaining protein functionality. Based on standard protocols for similar bacterial recombinant proteins and the product specifications indicating >85% purity by SDS-PAGE , the following methodological workflow has proven effective.

Affinity chromatography represents the primary purification step, with the specific approach determined by the fusion tag incorporated into the recombinant construct. For His-tagged variants, immobilized metal affinity chromatography (IMAC) using Ni-NTA resins provides efficient single-step enrichment. For biotinylated variants like CSB-EP451791EYZ1-B, streptavidin-based affinity matrices offer exceptional binding specificity and capacity . The elution conditions must be optimized to balance protein recovery with maintenance of structural integrity.

Following initial affinity purification, size exclusion chromatography (SEC) serves as an effective polishing step to remove aggregates and contaminating proteins of significantly different molecular weights. For applications requiring exceptionally high purity, ion exchange chromatography can be implemented as an intermediate step, with the selection of cation or anion exchange determined by the protein's isoelectric point.

Researchers should note that PMI1443 is provided as a lyophilized powder, necessitating reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL before purification procedures . The addition of 5-50% glycerol to the final purified product is recommended to enhance stability during storage, with 50% being the manufacturer's default concentration . This strategic approach to purification typically yields protein with purity exceeding 85% as confirmed by SDS-PAGE, suitable for most research applications.

How can quasi-experimental designs be applied to study the antimicrobial resistance mechanisms in P. mirabilis related to PMI1443?

Quasi-experimental designs offer valuable methodological frameworks for investigating antimicrobial resistance mechanisms in Proteus mirabilis, particularly when focusing on the potential role of the UPF0442 protein PMI1443. These study designs are especially useful when randomization is impractical or ethical constraints limit experimental manipulation. When applying quasi-experimental approaches to PMI1443 research, researchers should strategically select designs that minimize threats to internal validity.

More robust approaches include interrupted time-series designs, which involve multiple measurements before and after PMI1443 modification or inhibition. This design helps distinguish intervention effects from natural variations in bacterial populations and can reveal whether PMI1443 alterations produce immediate or gradual changes in resistance profiles. For optimal validity, researchers should:

  • Establish stable baseline measurements of antimicrobial susceptibility

  • Ensure consistent measurement techniques throughout the study

  • Collect sufficient post-intervention data points to detect trends

  • Control for potential confounding variables such as growth conditions

Further validity can be achieved through nonequivalent control group designs, comparing wild-type P. mirabilis strains with PMI1443 knockout or overexpression variants. When implementing this approach, researchers must address selection threats by carefully matching experimental and control strains for other genetic and phenotypic characteristics beyond PMI1443 status. Systematic differences between strains could confound interpretation of results attributable specifically to PMI1443 .

What analytical techniques are most appropriate for characterizing the structural properties of recombinant PMI1443 protein?

Comprehensive structural characterization of recombinant Proteus mirabilis UPF0442 protein PMI1443 requires a multi-technique analytical approach to elucidate primary sequence, secondary and tertiary structure, and potential functional domains. The methodological strategy should begin with primary structure confirmation and progress toward increasingly complex structural elements.

Mass spectrometry (MS) techniques, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), provide essential verification of the primary sequence and post-translational modifications. For recombinant PMI1443, which is produced at >85% purity according to SDS-PAGE analysis , peptide mass fingerprinting can confirm sequence integrity while identifying any unexpected modifications introduced during expression. Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) MS offers complementary information about intact protein mass and potential heterogeneity.

Complementary biophysical techniques including differential scanning calorimetry (DSC), isothermal titration calorimetry (ITC), and surface plasmon resonance (SPR) should be employed to characterize thermal stability, binding interactions, and kinetic properties. These approaches are particularly valuable when using the biotinylated variant (CSB-EP451791EYZ1-B) , which facilitates oriented immobilization for interaction studies.

What methodological approaches can resolve contradictory data when studying PMI1443's role in antibiotic resistance?

Resolving contradictory data regarding PMI1443's role in antibiotic resistance requires a systematic multi-faceted approach that integrates diverse experimental methodologies, controls for variables, and addresses potential sources of experimental bias. The inconsistencies often observed in protein function studies may stem from variations in experimental conditions, strain differences, or technical limitations that must be methodically addressed.

First, researchers should implement a structured replication strategy encompassing both technical and biological replication. Technical replicates (multiple measurements of the same sample) assess measurement precision, while biological replicates (independent samples of the same experimental condition) evaluate biological variability. For PMI1443 studies, biological replication should include multiple independent clones of gene knockout or overexpression variants to control for potential off-target genetic effects. Statistical power analysis should guide sample size determination to ensure sufficient sensitivity to detect biologically meaningful effects.

Contradictory findings may result from strain-specific differences, as P. mirabilis exhibits considerable genetic diversity. Comparative studies using the reference strain HI4320 alongside clinical isolates can reveal whether PMI1443's role in resistance is conserved or varies across strains. Whole genome sequencing should accompany these experiments to identify genetic differences that might explain discrepant resistance phenotypes.

A triangulation approach employing complementary methodologies can provide converging evidence regarding PMI1443's function. This should include:

  • Genetic approaches: Clean gene knockouts using CRISPR-Cas9 or allelic exchange, complementation studies, and controlled gene expression systems

  • Biochemical approaches: In vitro interaction studies with antibiotics, enzyme activity assays, and binding kinetics analysis

  • Structural approaches: Structure-function analyses based on protein modeling, site-directed mutagenesis of predicted functional domains

  • Systems biology approaches: Transcriptomics and proteomics to identify compensatory mechanisms that might mask PMI1443's effects

The experimental design should explicitly control for potential confounding variables identified in quasi-experimental design literature , including selection bias, history effects, and instrumentation changes. When analyzing antibiotic resistance phenotypes, standardized methods such as minimum inhibitory concentration (MIC) determination should follow CLSI guidelines to ensure comparability across studies.

How can the biotinylated variant of PMI1443 (CSB-EP451791EYZ1-B) be utilized in advanced protein interaction studies?

The biotinylated variant of PMI1443 (CSB-EP451791EYZ1-B), produced through AviTag-BirA technology with site-specific biotinylation , offers exceptional capabilities for advanced protein interaction studies through controlled orientation and stable immobilization. This methodological approach leverages the extremely high affinity between biotin and streptavidin (Kd ≈ 10^-15 M) to create stable experimental platforms for investigating PMI1443's potential binding partners and functional relationships.

Protein microarray analysis represents a powerful application for biotinylated PMI1443, enabling high-throughput screening of interaction partners. By immobilizing the biotinylated protein on streptavidin-coated slides in a spatially defined manner, researchers can probe against proteome libraries derived from P. mirabilis or host tissues. This oriented immobilization ensures that potential binding domains remain accessible, unlike random chemical coupling methods that may obscure interaction sites. Fluorescently labeled proteins or antibodies can detect binding events, with quantitative signal analysis revealing relative binding affinities.

For kinetic analysis of specific interactions, surface plasmon resonance (SPR) or bio-layer interferometry (BLI) using biotinylated PMI1443 provides real-time, label-free detection of binding events. The methodological workflow involves:

  • Immobilizing biotinylated PMI1443 on streptavidin-coated sensor chips or tips

  • Flowing potential interaction partners across the surface at varying concentrations

  • Measuring association and dissociation rates to calculate binding constants

  • Performing competitive inhibition assays to confirm binding specificity

This approach reveals not only whether interactions occur but also provides valuable kinetic parameters including kon, koff, and KD values. These parameters can help distinguish biologically relevant interactions from non-specific binding events.

Co-immunoprecipitation studies gain precision through biotinylated PMI1443, with streptavidin magnetic beads enabling efficient capture of protein complexes from bacterial lysates. This approach can identify in vivo interaction partners when coupled with mass spectrometry for protein identification. The site-specific nature of the biotinylation minimizes the risk of the biotin tag interfering with natural binding sites, a common limitation in traditional tagged protein approaches.

For structural studies, biotinylated PMI1443 can be anchored to lipid nanodiscs or other membrane mimetics to investigate potential membrane associations, particularly relevant given P. mirabilis' resistance mechanisms involving membrane transporters and efflux systems described in the literature .

What controls are essential when studying the potential role of PMI1443 in P. mirabilis antibiotic resistance mechanisms?

Robust experimental design for investigating PMI1443's role in Proteus mirabilis antibiotic resistance requires comprehensive controls that address potential confounding variables and alternative explanations for observed phenotypes. As P. mirabilis exhibits complex resistance mechanisms including β-lactamases, efflux pumps, porin modifications, and target alterations , isolating PMI1443's specific contributions necessitates meticulously designed control strategies.

Genetic manipulation controls must address both intended and unintended consequences of PMI1443 modification. For gene knockout or knockdown experiments, complementation controls are essential—reintroducing the wild-type PMI1443 gene should restore the original phenotype if observed changes are specifically attributable to PMI1443 loss. Additionally, researchers should implement empty vector controls that undergo identical selection procedures to account for potential artifacts introduced during genetic manipulation. For CRISPR-Cas9 approaches, off-target control experiments using scrambled guide RNAs can identify potential off-target effects.

Phenotypic assessment controls should include:

  • Multiple reference strains: Testing both laboratory reference strain HI4320 and recent clinical isolates to account for strain variability

  • Antibiotic panel controls: Testing multiple classes of antibiotics to distinguish between specific and general resistance effects

  • Growth condition controls: Evaluating resistance under various environmental conditions to identify context-dependent effects

  • Temporal controls: Monitoring resistance profiles over time to distinguish between immediate and adaptive responses

When conducting comparative gene expression studies, careful selection of housekeeping genes for normalization is critical. Traditional references such as 16S rRNA may not maintain constant expression under antibiotic stress, necessitating validation of multiple reference genes specifically stable in P. mirabilis under experimental conditions.

The quasi-experimental design literature emphasizes controlling for history effects (concurrent events that might cause observed changes) and instrumentation effects (changes in measurement precision over time) . These considerations translate to microbiological research through strict standardization of media preparation, growth conditions, and antibiotic susceptibility testing protocols throughout the experimental timeline. Researchers should also implement technical replicates to assess measurement variation and biological replicates (multiple independent clones or isolates) to evaluate biological variability.

How can researchers design experiments to distinguish between direct and indirect effects of PMI1443 on antibiotic resistance?

Distinguishing between direct and indirect effects of PMI1443 on antibiotic resistance in Proteus mirabilis requires sophisticated experimental designs that establish causal pathways and mechanistic relationships. This methodological challenge is particularly significant given the interconnected nature of bacterial resistance mechanisms and potential compensatory pathways that may activate when PMI1443 function is altered.

Temporal analysis experiments offer critical insights into the sequence of molecular events following PMI1443 manipulation. Time-course studies measuring gene expression, protein activity, and resistance phenotypes can reveal whether changes occur simultaneously or in a sequential pattern suggestive of a causal chain. Researchers should implement interrupted time-series designs with multiple measurement points before and after PMI1443 manipulation, addressing maturation threats to validity as described in the quasi-experimental design literature . High-temporal-resolution techniques such as real-time RT-PCR, live-cell imaging with fluorescent reporters, or continuous monitoring of growth in the presence of antibiotics can capture the dynamics of these processes.

Molecular interaction studies provide direct evidence of PMI1443's functional relationships. Methodological approaches include:

  • In vitro biochemical assays testing direct interactions between purified PMI1443 and antibiotics or antibiotic targets

  • Protein-protein interaction studies using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or surface plasmon resonance with the biotinylated PMI1443 variant (CSB-EP451791EYZ1-B)

  • Subcellular localization studies using fluorescently tagged PMI1443 to determine whether it co-localizes with known resistance machinery

Genetic epistasis analysis represents a powerful approach to establish pathway relationships. By creating double mutants lacking both PMI1443 and known resistance factors (e.g., specific efflux pumps, beta-lactamases), researchers can determine whether the effects are additive (suggesting parallel pathways) or non-additive (suggesting sequential action in the same pathway). This experimental design requires precise genetic manipulation techniques and quantitative phenotypic assessments.

Systems biology approaches can map the broader network effects of PMI1443 perturbation. RNA-seq transcriptomics and quantitative proteomics before and after PMI1443 manipulation can identify altered regulatory networks and compensatory mechanisms. Pathway enrichment analysis and network modeling can then distinguish between direct targets and downstream effects. When implementing these methodologies, researchers should explicitly control for selection threats to validity by ensuring experimental and control bacterial populations are matched in all characteristics except PMI1443 status.

What methodological considerations are important when investigating PMI1443's potential role in biofilm formation?

Investigating PMI1443's potential role in Proteus mirabilis biofilm formation requires specialized methodological considerations that address the unique characteristics of P. mirabilis crystalline biofilms and their relationship to multidrug resistance. As P. mirabilis biofilms present a major clinical challenge in catheter-associated urinary tract infections (CAUTIs) , understanding PMI1443's contribution to this process has significant translational relevance.

Quantification approaches should encompass multiple biofilm parameters:

  • Biomass quantification: Crystal violet staining with spectrophotometric measurement for total biomass

  • Viability assessment: Colony forming unit (CFU) enumeration or fluorescent viability stains (e.g., LIVE/DEAD BacLight)

  • Matrix component analysis: Specific staining for polysaccharides (Concanavalin A), proteins (SYPRO Ruby), and extracellular DNA (DAPI)

  • Structural characterization: Confocal laser scanning microscopy with 3D reconstruction and quantitative parameters (biovolume, surface-to-volume ratio, roughness coefficient)

P. mirabilis biofilms uniquely incorporate crystalline components, primarily struvite and apatite, requiring additional specialized methodologies:

  • Crystal formation quantification using calcium and magnesium colorimetric assays

  • Microscopic crystal analysis via scanning electron microscopy (SEM) with energy-dispersive X-ray spectroscopy (EDS) for elemental composition

  • pH monitoring throughout biofilm development, as P. mirabilis urease activity raises pH, promoting crystal formation

Temporal considerations are crucial when designing these experiments. P. mirabilis biofilms develop through distinct phases, including initial attachment, microcolony formation, maturation, and crystalline development. Experimental timepoints should capture these stages, typically requiring observations at 4, 24, 48, and 72 hours, with extended timepoints (up to 7 days) for complete crystalline biofilm development.

When implementing gene manipulation approaches (knockouts, knockdowns, or overexpression of PMI1443), researchers must control for potential pleiotropic effects that might indirectly affect biofilm formation. Complementation studies reintroducing wild-type or mutated PMI1443 variants can help establish causal relationships. Additionally, researchers should assess whether PMI1443 manipulation affects swarming motility, urease activity, or fimbrial expression—all factors known to influence P. mirabilis biofilm development.

What approaches can determine if PMI1443 interacts directly with antibiotics or antibiotic targets?

Determining whether PMI1443 interacts directly with antibiotics or their cellular targets requires a systematic biochemical approach incorporating multiple complementary techniques. These methodologies must distinguish specific binding events from non-specific interactions and should provide quantitative parameters characterizing binding affinity, stoichiometry, and thermodynamics.

In vitro binding assays using purified recombinant PMI1443 represent the foundational approach. Direct binding to antibiotics can be assessed through equilibrium dialysis, where the protein and antibiotic are separated by a semi-permeable membrane allowing only the antibiotic to diffuse freely. After equilibration, antibiotic concentrations are measured in both chambers, with a higher concentration in the protein chamber indicating binding. This technique can be enhanced using radiolabeled or fluorescently tagged antibiotics for increased sensitivity and specificity.

Biophysical interaction analysis using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides quantitative binding parameters. For SPR studies, the biotinylated PMI1443 variant (CSB-EP451791EYZ1-B) offers distinct advantages through oriented immobilization on streptavidin-coated sensor chips. This approach allows real-time monitoring of association and dissociation kinetics when various antibiotics flow across the immobilized protein, generating kon, koff, and KD values that characterize binding strength and dynamics. Complementary ITC measurements provide thermodynamic parameters (ΔH, ΔS, ΔG) that offer insights into binding mechanisms.

For investigating potential interactions with antibiotic targets rather than antibiotics themselves, researchers should implement protein-protein interaction studies. These may include:

  • Pull-down assays using biotinylated PMI1443 to capture potential interacting partners from bacterial lysates

  • Förster resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) to detect proximity between tagged PMI1443 and candidate target proteins in solution

  • Microscale thermophoresis to measure interactions based on changes in thermophoretic mobility upon binding

Structural studies combining X-ray crystallography or NMR spectroscopy with molecular docking simulations can identify potential binding sites and interaction mechanisms. Co-crystallization of PMI1443 with antibiotics or target proteins provides definitive evidence of direct interactions and reveals atomic-level binding determinants. When crystal structures cannot be obtained, hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers an alternative approach to identify regions of PMI1443 that become protected upon ligand binding, indicating potential interaction interfaces.

Functional validation of identified interactions should follow, demonstrating that the binding events have biological consequences. Enzymatic assays measuring the impact of PMI1443 on target protein activity, or competition assays showing displacement of antibiotics from their targets, provide this critical connection between biochemical observations and biological relevance.

How can researchers effectively compare wild-type and mutant forms of PMI1443 to identify functional domains?

Effective comparison of wild-type and mutant forms of PMI1443 requires a comprehensive structure-function analysis strategy that systematically identifies domains critical for protein activity. This methodology relies on rational mutagenesis approaches guided by computational predictions, followed by rigorous functional characterization using multiple complementary assays.

The experimental workflow should begin with in silico analysis to guide mutant design. Sequence alignment with homologous proteins of known function can identify conserved residues likely critical for PMI1443 activity. Further computational approaches should include:

  • Secondary structure prediction to identify α-helices, β-sheets, and unstructured regions

  • Tertiary structure modeling using homology modeling or ab initio prediction methods

  • Domain prediction to identify potential functional units within the protein

  • Molecular dynamics simulations to assess conformational flexibility and potential binding sites

Based on these computational predictions, researchers should design a panel of PMI1443 mutants including:

  • Domain deletion mutants removing predicted functional units

  • Point mutations targeting conserved residues within predicted active sites

  • Alanine scanning mutations systematically replacing surface-exposed residues

  • Charge-reversal mutations altering the electrostatic properties of specific regions

Expression and purification of these mutants should follow standardized protocols ensuring >85% purity by SDS-PAGE , with careful verification that mutations do not cause catastrophic folding defects. Circular dichroism spectroscopy comparing wild-type and mutant proteins can confirm preservation of secondary structure elements, while size exclusion chromatography can detect aggregation or oligomerization changes.

Functional characterization should employ multiple assays addressing different aspects of PMI1443 activity. If investigating potential roles in antibiotic resistance, these assays might include:

  • Antibiotic binding assays comparing wild-type and mutant binding affinities

  • Enzymatic activity measurements if PMI1443 possesses catalytic functions

  • Protein-protein interaction studies with known binding partners

  • Membrane association assays if PMI1443 interacts with bacterial membranes

Complementary in vivo approaches should assess the biological significance of identified domains. Gene complementation experiments introducing mutant PMI1443 variants into knockout strains can demonstrate which mutations affect function in living bacteria. These experiments should evaluate phenotypes relevant to potential PMI1443 functions, such as antibiotic susceptibility, biofilm formation capacity, or stress response.

The structured comparative analysis should be presented in tabular format, systematically documenting the effects of each mutation across multiple functional parameters. This approach creates a comprehensive structure-function map of PMI1443, identifying regions critical for specific activities and providing insights into the molecular mechanisms underlying its biological roles.

How does PMI1443 potentially contribute to the multidrug resistance mechanisms in P. mirabilis?

The potential contribution of PMI1443 to multidrug resistance mechanisms in Proteus mirabilis must be considered within the complex landscape of established resistance determinants. While the specific function of this UPF0442 family protein remains incompletely characterized, several hypothetical mechanisms warrant investigation based on structural predictions and the known resistance pathways in P. mirabilis.

P. mirabilis employs multiple resistance mechanisms including β-lactamase production, efflux pump overexpression, porin modifications, and target alterations . PMI1443 may intersect with these established pathways through direct or regulatory interactions. Structural analysis suggests PMI1443 contains domains potentially compatible with enzymatic activity, membrane association, or regulatory functions, each offering distinct mechanisms for resistance contribution.

One compelling hypothesis positions PMI1443 as a novel accessory protein modulating efflux pump efficiency. The increasing prevalence of multidrug-resistant (MDR) P. mirabilis strains correlates with enhanced efflux activity, and accessory proteins that stabilize pump complexes or facilitate their assembly could significantly impact resistance profiles. This model warrants investigation through co-immunoprecipitation studies using biotinylated PMI1443 variants to identify potential interactions with known efflux components.

Alternatively, PMI1443 may function as a novel resistance determinant through direct antibiotic modification or sequestration. This mechanism would align with P. mirabilis's documented capacity to acquire resistance through mobile genetic elements encoding antibiotic-modifying enzymes . Biochemical assays measuring antibiotic degradation or modification in the presence of purified PMI1443 could evaluate this possibility.

The regulatory hypothesis positions PMI1443 as a transcriptional or post-transcriptional regulator influencing expression of established resistance determinants. P. mirabilis resistance often involves complex regulatory networks responding to antibiotic pressure, and PMI1443 could function within these signaling cascades. Transcriptome analysis comparing wild-type and PMI1443 knockout strains under antibiotic stress could reveal regulatory targets.

Cross-resistance profiling represents a critical experimental approach to distinguish between these mechanisms. PMI1443 manipulation (knockout or overexpression) followed by systematic minimum inhibitory concentration (MIC) determination across diverse antibiotic classes can reveal patterns indicative of specific resistance mechanisms:

  • Broad-spectrum resistance changes affecting multiple antibiotic classes would suggest regulatory functions

  • Class-specific effects limited to particular antibiotics would indicate direct interaction mechanisms

  • Intermediate patterns might suggest efflux pump modulation with varying substrate specificities

The clinical significance of PMI1443 in multidrug resistance should be assessed through comparative genomics approaches examining its conservation, expression levels, and potential mutations across clinical isolates with varying resistance profiles. This epidemiological perspective can establish whether PMI1443 variants correlate with resistance phenotypes in clinical settings.

What methodological approaches can assess whether PMI1443 contributes to P. mirabilis biofilm-associated resistance?

Assessing PMI1443's contribution to Proteus mirabilis biofilm-associated resistance requires specialized methodological approaches that address the unique characteristics of biofilm-mediated protection while isolating PMI1443-specific effects. The research strategy must consider that P. mirabilis forms crystalline biofilms in catheter-associated urinary tract infections (CAUTIs), which represent a major clinical challenge due to their multidrug resistance properties .

Comparative biofilm susceptibility testing forms the cornerstone of this assessment. This methodology contrasts antibiotic efficacy against wild-type and PMI1443 mutant strains in both planktonic and biofilm growth modes. The experimental design should include:

  • Minimum inhibitory concentration (MIC) determination for planktonic bacteria

  • Minimum biofilm eradication concentration (MBEC) determination using biofilm-specific assay systems

  • Calculation of the MBEC/MIC ratio as a quantitative measure of biofilm-specific resistance

The Calgary Biofilm Device or similar biofilm-specific testing platforms should be employed to ensure standardized biofilm formation and antibiotic exposure. Testing should encompass multiple antibiotic classes to distinguish between general biofilm protection mechanisms and antibiotic-specific effects potentially linked to PMI1443.

Biofilm architecture analysis using confocal laser scanning microscopy with fluorescent staining can reveal whether PMI1443 manipulation alters structural features that contribute to antibiotic penetration barriers. Three-dimensional reconstruction with quantitative analysis of parameters including:

  • Biofilm thickness and biovolume

  • Extracellular matrix density and composition

  • Water channel formation and distribution

  • Spatial distribution of metabolically active cells versus dormant persisters

These structural assessments should be complemented with antibiotic penetration studies using fluorescently labeled antibiotics to directly visualize diffusion dynamics through biofilms formed by wild-type versus PMI1443 mutant strains. Time-lapse imaging can capture kinetic aspects of penetration, while quantitative image analysis can provide penetration rates and depth profiles.

Mechanistic investigations should address specific biofilm resistance mechanisms potentially influenced by PMI1443:

  • Matrix production: Quantitative analysis of exopolysaccharides, extracellular DNA, and proteins in the matrix

  • Persister cell formation: Enumeration of antibiotic-tolerant persister cells within biofilms

  • Metabolic adaptation: Measurement of metabolic activity gradients using respiratory indicators

  • Horizontal gene transfer: Assessment of conjugation frequencies within biofilms

Gene expression analysis represents another critical approach, comparing transcriptional profiles between planktonic and biofilm growth for both wild-type and PMI1443 mutant strains. RNA-seq or targeted RT-qPCR can identify genes differentially regulated in a PMI1443-dependent manner specifically during biofilm growth. This approach can reveal whether PMI1443 influences expression of known resistance determinants or stress response mechanisms specifically in the biofilm state.

How can PMI1443 research contribute to developing novel therapeutic strategies against resistant P. mirabilis infections?

Research on PMI1443 offers multiple avenues toward developing novel therapeutic strategies against resistant Proteus mirabilis infections, with approaches ranging from direct targeting to exploitation as a biomarker or diagnostic tool. The increasing prevalence of multidrug-resistant P. mirabilis strains, particularly in catheter-associated urinary tract infections (CAUTIs) , creates an urgent need for alternative treatment approaches that circumvent established resistance mechanisms.

If structural and functional characterization reveals PMI1443 as essential for P. mirabilis virulence or resistance, direct targeting becomes a viable therapeutic strategy. This approach would require:

  • High-resolution structural determination of PMI1443 using X-ray crystallography or cryo-electron microscopy

  • Identification of druggable pockets through computational solvent mapping

  • Structure-based virtual screening against these pockets to identify potential inhibitors

  • Biochemical validation of binding and inhibition using purified recombinant protein

  • Cellular validation demonstrating that inhibition restores antibiotic susceptibility or reduces virulence

The biotinylated variant of PMI1443 (CSB-EP451791EYZ1-B) offers particular advantages for high-throughput screening applications, enabling oriented immobilization on streptavidin surfaces for fragment-based drug discovery approaches. This methodology can identify small molecular fragments that bind to different regions of the protein, which can subsequently be linked to create high-affinity inhibitors.

If PMI1443 functions within complex networks rather than as a stand-alone resistance determinant, systems biology approaches become essential for therapeutic development. Network analysis identifying synthetic lethal interactions with PMI1443 could reveal combination therapy opportunities where PMI1443 inhibition sensitizes bacteria to existing antibiotics or creates new vulnerabilities. This approach requires:

  • Genome-wide interaction screens using techniques such as transposon sequencing (Tn-seq)

  • Computational modeling of PMI1443-centered interaction networks

  • Experimental validation of predicted synergistic targets

Immunotherapeutic approaches represent another promising avenue if PMI1443 is surface-exposed or secreted. Recombinant PMI1443 with high purity (>85% by SDS-PAGE) could serve as an antigen for vaccine development or for generating therapeutic antibodies. The efficacy of this approach would depend on:

  • Confirmation of PMI1443 accessibility to antibodies in living bacteria

  • Demonstration that antibody binding inhibits PMI1443 function

  • In vivo studies showing protection in animal infection models

Diagnostic applications should not be overlooked, particularly if PMI1443 expression correlates with resistance profiles or virulence potential. Development of rapid diagnostic tests detecting PMI1443 expression levels could guide treatment decisions and antimicrobial stewardship. This approach would require:

  • Development of specific antibodies or aptamers recognizing PMI1443

  • Creation of sensitive detection platforms suitable for clinical specimens

  • Clinical validation correlating PMI1443 detection with treatment outcomes

Finally, if PMI1443 proves integral to P. mirabilis biofilm formation, anti-biofilm strategies specifically targeting PMI1443-dependent processes could address the recalcitrant nature of P. mirabilis infections in catheterized patients . This might include surface coatings that inhibit PMI1443 function or release PMI1443 inhibitors to prevent biofilm establishment on medical devices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.