Recombinant Protobothrops elegans NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Metabolism

MT-ND4 functions as a critical component of Complex I (NADH:ubiquinone oxidoreductase), which represents the first enzyme complex in the mitochondrial electron transport chain . This complex plays a pivotal role in cellular energy production through oxidative phosphorylation, the process by which cells generate the majority of their adenosine triphosphate (ATP) .

Role in Oxidative Phosphorylation

Within mitochondria, MT-ND4 contributes to Complex I's primary function: the transfer of electrons from NADH to ubiquinone . This electron transfer process is coupled with proton pumping across the inner mitochondrial membrane, creating an electrochemical gradient that ultimately drives ATP synthesis . Specifically, Complex I performs the initial step in the electron transport process by catalyzing the transfer of electrons from NADH to ubiquinone, with electrons subsequently moving through several other enzyme complexes to provide energy for ATP generation .

The oxidative phosphorylation process occurs within the inner mitochondrial membrane, where Complex I and other respiratory chain complexes are embedded in a tightly folded configuration . The electron transport across these complexes creates an unequal electrical charge on either side of the membrane, providing the necessary energy potential for ATP production .

Evolutionary Conservation

MT-ND4 demonstrates remarkable evolutionary conservation across species, with homologous proteins found in various organisms from bacteria to mammals . The NADH-ubiquinone oxidoreductase complex occurs in mitochondria of eukaryotes and in plasma membranes of purple photosynthetic bacteria and related respiratory bacteria . This conservation highlights the fundamental importance of this protein in cellular energy metabolism throughout evolutionary history.

Recombinant Expression and Production

The recombinant Protobothrops elegans MT-ND4 protein is produced using E. coli expression systems, which allow for high-yield production of this otherwise difficult-to-isolate membrane protein . The expression in bacterial systems enables researchers to obtain sufficient quantities of the protein for various experimental applications, including structural studies and functional assays.

Expression System Details

The production process typically involves cloning the MT-ND4 gene into a suitable expression vector containing a histidine tag sequence, transformation into competent E. coli cells, and induction of protein expression . Following expression, the protein undergoes purification procedures, typically involving affinity chromatography, to isolate the His-tagged protein from other cellular components .

Post-purification processing includes:

  1. Validation of purity using SDS-PAGE analysis

  2. Concentration determination

  3. Lyophilization for long-term storage stability

The final product is formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during storage .

Reconstitution Protocol

Before opening, the protein vial should be briefly centrifuged to bring contents to the bottom . The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage of reconstituted protein, the addition of 5-50% glycerol (final concentration) is recommended before aliquoting and storing at -20°C/-80°C . The manufacturer's default recommendation includes a final glycerol concentration of 50% .

Research Applications

Recombinant Protobothrops elegans MT-ND4 serves multiple purposes in biochemical and biomedical research fields. The protein finds applications in various experimental contexts:

Comparative Biochemistry

The Protobothrops elegans MT-ND4 offers valuable opportunities for comparative studies of mitochondrial function across different species . Such research can illuminate evolutionary adaptations in energy metabolism pathways and identify conserved functional domains across diverse taxa .

Disease Model Research

Studies involving recombinant MT-ND4 can contribute to understanding mitochondrial disorders, as mutations in the MT-ND4 gene in humans are associated with conditions like Leber hereditary optic neuropathy . Research using model organisms like Caenorhabditis elegans has demonstrated that alternative NADH dehydrogenases can compensate for Complex I deficiency, suggesting potential therapeutic approaches for mitochondrial diseases .

Molecular Context in Complex I

As part of Complex I, MT-ND4 integrates into a larger molecular assembly with distinct structural features. Electron microscopy and image reconstruction have revealed that Complex I adopts a characteristic L-shaped or boot-shaped structure, with two main subcomplexes that can be dissociated .

Disease Associations

Mutations in Complex I components, including MT-ND4, have been linked to several human diseases . These include:

  1. Leber hereditary optic neuropathy - an inherited form of vision loss

  2. MELAS syndrome (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes)

  3. Potential associations with Alzheimer's disease

The G11778A (Arg340His) variant in the human MT-ND4 gene is particularly significant, representing approximately 70% of all Leber hereditary optic neuropathy cases worldwide .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development if possible.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGIIRMMQVLPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWSLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTTTWWLLTNLMNIATPPTLNFTSELLIMSSLFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGPTLLDNQTEPTHSREHLLMALHIIPLVMISMKPELII
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be part of the minimal assembly required for catalytic activity. Complex I functions in the transfer of electrons from NADH to the respiratory chain. Ubiquinone is thought to be the immediate electron acceptor for this enzyme.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what is its role in mitochondrial function?

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is an essential mitochondrial protein encoded by the mitochondrial genome and serves as a core subunit of complex I in the electron transport chain. This protein plays a crucial role in cellular respiration by facilitating electron transfer from NADH to ubiquinone, contributing to the establishment of the proton gradient necessary for ATP synthesis.

Recent research has revealed that MT-ND4 contains alternative open reading frames, with one downstream alternative ATG initiation codon in the +3 reading frame encoding a 99-amino-acid polypeptide (MTALTND4) that impacts both cellular and mitochondrial physiology . This finding suggests MT-ND4 has a more complex functional repertoire than previously understood, potentially influencing mitochondrial metabolism beyond its canonical role in the electron transport chain.

How does MT-ND4 compare to similar proteins in other species?

Comparative analysis between Protobothrops elegans MT-ND4 and orthologs in other species reveals evolutionary conservation of function with species-specific adaptations. When examining related mitochondrial proteins:

  • In Caenorhabditis elegans, UCP4 functions as a critical regulator of mitochondrial succinate import and complex II-mediated metabolism, with knockout mutants exhibiting sharply decreased mitochondrial succinate-driven respiration while maintaining normal respiratory coupling and electron transport chain function .

  • The alternative reading frame product identified within human MT-ND4 (MTALTND4) is conserved in primates and has been confirmed through immunoprecipitation from HeLa cell lysates, establishing that such alternative encoded proteins exist endogenously .

  • Mitochondrial proteins in Protobothrops species often undergo significant post-translational modifications, with high expression of protein disulfide isomerases (PDIs) like P4HB, PDIA3, SELENOM, and calreticulin (CALR) in venom gland tissue, which may have parallels in other tissues expressing mitochondrial proteins .

What methods are available for isolating functional recombinant MT-ND4?

Isolation of functional recombinant MT-ND4 requires careful consideration of protein structure and mitochondrial membrane integration properties. The recommended protocol includes:

  • Expression system selection: Bacterial systems (E. coli) with specialized membrane protein expression vectors yield moderate success, while eukaryotic systems (insect cells, particularly Sf9) offer superior folding for mitochondrial membrane proteins.

  • Solubilization strategy: A two-phase extraction employing mild detergents (n-dodecyl-β-D-maltoside at 1-2% concentration) followed by gentle membrane dissolution preserves protein structure and function.

  • Purification approach: Tandem affinity chromatography using His-tag followed by size exclusion chromatography achieves >90% purity while maintaining native conformation.

  • Functional validation: Spectrophotometric assays measuring NADH oxidation rates (monitoring absorbance at 340 nm) confirm preserved electron transfer capability of the recombinant protein.

The isolation of fully functional MT-ND4 remains challenging due to its hydrophobic nature and dependence on the mitochondrial membrane environment, similar to challenges observed with C. elegans UCP4 protein studied in isolated mitochondrial preparations .

How can researchers effectively measure MT-ND4 activity in experimental systems?

Measuring MT-ND4 activity requires specialized approaches that assess both its canonical function in the electron transport chain and potential alternative functions:

  • Isolated mitochondria respirometry: Oxygen consumption measurements using substrate-specific protocols can differentiate between complex I-dependent (with malate as substrate) and complex II-dependent (with succinate as substrate) respiration. This allows researchers to parse out MT-ND4 contribution to mitochondrial function, similar to approaches used in C. elegans UCP4 studies where knockout mutants exhibited normal malate-driven respiration but severely impaired succinate-driven respiration .

  • Blue native PAGE with in-gel activity assays: This technique allows visualization of intact respiratory complexes separated by electrophoresis, with subsequent activity staining using NADH and electron acceptors to quantify complex I activity where MT-ND4 functions.

  • Membrane potential measurements: Using potentiometric dyes like JC-1 or TMRM to assess proton gradient generation provides indirect measurement of MT-ND4 function within complex I.

  • Mitochondrial metabolite profiling: Targeted metabolomics focusing on TCA cycle intermediates and electron transport chain substrates can reveal alterations in metabolic flux resulting from MT-ND4 dysfunction or modification.

  • Assessing alternative reading frame products: Custom antibodies against predicted alternative reading frame products (similar to MTALTND4) can be used for immunoprecipitation to confirm their expression and subcellular localization through immunofluorescence microscopy .

What model systems are most appropriate for studying Protobothrops elegans MT-ND4?

The selection of appropriate model systems depends on specific research questions:

Model SystemAdvantagesLimitationsBest Applications
Heterologous cell lines (HEK293, HeLa)Ease of genetic manipulation; established mitochondrial assaysSpecies differences in mitochondrial biologyInitial characterization; protein-protein interactions
C. elegansSingle UCP ortholog simplifies functional studies; genetic tractabilityEvolutionary distance from vertebratesEvolutionary conservation studies; in vivo metabolic phenotyping
ZebrafishVertebrate model; mitochondrial genetics similar to mammalsDifferences from snake biologyDevelopmental and physiological studies
Snake cell linesMost relevant biological contextLimited availability; fewer genetic toolsSpecies-specific function; venom biology integration

When working with C. elegans as a model system, researchers can leverage the presence of only a single UCP ortholog (ceUCP4), which simplifies the study of mitochondrial protein function in vivo . This approach allows for detailed metabolic analyses in genetically modified organisms to define the function of mitochondrial proteins like MT-ND4.

How should researchers approach the study of alternative reading frames within MT-ND4?

Investigation of alternative reading frames within MT-ND4 requires a systematic approach:

  • Bioinformatic identification: Analyze the MT-ND4 sequence for alternative start codons (primarily ATG) in all reading frames, focusing on those with significant open reading frames (typically >30 amino acids) and conservation across related species.

  • Transcript confirmation: Utilize RNA-seq and targeted PCR to confirm transcription of regions containing potential alternative ORFs.

  • Proteomic validation: Employ custom antibodies against predicted peptides, similar to the approach used to confirm MTALTND4 expression, where custom antibodies successfully immunoprecipitated the endogenous peptide from cell lysates .

  • Functional characterization: Assess subcellular localization through immunofluorescence and impact on mitochondrial function using knockdown/overexpression approaches combined with respirometry, membrane potential measurements, and metabolic profiling.

The discovery that human mitochondrial nd4 gene contains a downstream alternative ATG initiation codon in the +3 reading frame provides a valuable template for similar investigations in Protobothrops elegans MT-ND4 .

How does MT-ND4 interact with mitochondrial surveillance and stress response pathways?

MT-ND4 function appears to be integrated with cellular stress response mechanisms:

  • Mitochondrial surveillance pathways: Evidence from C. elegans suggests that mitochondrial proteins like ARIP-4 DNA helicase couple mitochondrial surveillance to downstream immunity, detoxification, and RNA interference responses . MT-ND4 dysfunction likely triggers similar surveillance mechanisms.

  • Transcriptional response networks: Mitochondrial dysfunction activates specific transcriptional programs, such as the activation of cytochrome p450 detoxification gene cyp-14A4 observed in C. elegans . Similar pathways may respond to MT-ND4 impairment.

  • Metabolic adaptation mechanisms: When MT-ND4 function is compromised, cells may upregulate alternative metabolic pathways. In C. elegans ucp4 knockout mutants, reduced mitochondrial respiration was accompanied by increased lipid accumulation and altered metabolite profiles, suggesting compensatory metabolic adaptations .

  • Protein quality control integration: MT-ND4 likely interacts with mitochondrial protein quality control machinery, potentially involving PDI family proteins identified in Protobothrops species, which facilitate proper folding of proteins with multiple disulfide bonds .

What are the functional consequences of mutations in Protobothrops elegans MT-ND4?

MT-ND4 mutations can have diverse functional impacts depending on their location and nature:

How might recombinant MT-ND4 be used to study mitochondrial disease mechanisms?

Recombinant MT-ND4 offers several approaches to investigate mitochondrial disease:

  • Structure-function relationship studies: Site-directed mutagenesis of recombinant MT-ND4 can recreate disease-associated variants to assess their impact on protein stability, complex I integration, and electron transfer capacity.

  • Drug screening platforms: Purified recombinant MT-ND4 incorporated into artificial membrane systems allows high-throughput screening of compounds that might restore function to mutant variants.

  • Interaction network mapping: Using techniques like proximity labeling with recombinant MT-ND4 can identify physical and functional interaction partners, providing insights into how mutations disrupt broader mitochondrial processes.

  • Mitochondrial import investigation: Studies with recombinant MT-ND4 can reveal how this mitochondrially-encoded protein is integrated into the inner membrane and assembled into complex I, processes that might be therapeutic targets.

  • Alternative reading frame product studies: Recombinant expression of both canonical MT-ND4 and its alternative reading frame products enables exploration of their individual and combined functions in mitochondrial physiology .

How can researchers reconcile contradictory findings in MT-ND4 functional studies?

When facing contradictory results in MT-ND4 research, consider these methodological approaches:

  • System-specific effects analysis: Contradictions may arise from differences in experimental systems. In C. elegans studies, both genetic knockout and RNAi approaches confirmed the respiratory phenotype of UCP4 deficiency, demonstrating the importance of multiple validation approaches .

  • Context dependency evaluation: Assess whether contradictory findings might reflect true biological variability dependent on cellular context, developmental stage, or environmental conditions.

  • Technical variation assessment: Create a standardized methodology table comparing key experimental parameters (protein preparation, buffer composition, measurement conditions) across contradictory studies to identify potential technical sources of variation.

  • Alternative reading frame consideration: Apparent contradictions may result from differential effects on canonical versus alternative reading frame products of MT-ND4. The discovery of MTALTND4 encoded within the human nd4 gene illustrates how overlooked gene products can impact interpretation of functional studies .

  • Integrated data analysis: Apply meta-analysis techniques to quantitatively synthesize results across multiple studies, weighting results by methodological rigor and sample size.

What are the common pitfalls in analyzing MT-ND4 expression and activity data?

Researchers should be aware of these common analytical challenges:

How should researchers approach the integration of MT-ND4 data with broader mitochondrial function studies?

Integration of MT-ND4 data requires:

  • Multi-level analysis framework: Organize data across molecular (protein expression, modification), functional (enzyme activity, respiration), and phenotypic (metabolite profiles, cellular outcomes) levels to build coherent mechanistic models.

  • Temporal dynamics consideration: Acute versus chronic MT-ND4 dysfunction may trigger different compensatory responses. Time-course experiments capture these dynamic adaptations.

  • Pathway integration mapping: Connect MT-ND4 function to broader cellular processes using approaches similar to those that identified links between mitochondrial surveillance and immunity, detoxification, and RNAi responses in C. elegans .

  • Statistical integration methods: Apply multivariate statistical techniques (principal component analysis, partial least squares discrimination analysis) to identify patterns across complex multidimensional datasets.

  • Computational modeling: Develop in silico models of electron transport chain function incorporating experimental MT-ND4 data to predict system-level consequences of alterations.

How is alternative reading frame discovery changing our understanding of mitochondrial genes like MT-ND4?

The discovery of alternative reading frames in mitochondrial genes represents a paradigm shift:

  • Expanded functional repertoire: The identification of MTALTND4, a 99-amino-acid polypeptide encoded within the human nd4 gene, demonstrates that mitochondrial genes can produce multiple functional proteins with distinct subcellular localizations and biological activities .

  • Conservation patterns: Alternative reading frame products like MTALTND4 show evolutionary conservation patterns distinct from their canonical counterparts, suggesting independent functional selection .

  • Regulatory complexity: Alternative reading frames provide an additional layer of regulation, potentially allowing mitochondria to respond to different cellular conditions through differential translation of alternative products.

  • Disease mechanism implications: Mutations affecting alternative reading frame products without disrupting the canonical protein may explain previously mysterious disease associations or phenotypic variations.

  • Therapeutic opportunity expansion: Alternative reading frame products offer new potential therapeutic targets for mitochondrial disorders, potentially with fewer off-target effects than targeting canonical proteins.

The finding that MTALTND4 impacts both cell and mitochondrial physiology underscores the importance of investigating similar alternative products in Protobothrops elegans MT-ND4 .

What emerging technologies are advancing the study of recombinant mitochondrial proteins like MT-ND4?

Cutting-edge technologies transforming MT-ND4 research include:

  • Cryo-electron microscopy: Near-atomic resolution structures of intact respiratory complexes provide unprecedented insights into MT-ND4 integration and function within complex I.

  • Nanoscale respirometry: Microfluidic devices requiring minimal sample volumes enable high-resolution measurements of oxygen consumption in response to MT-ND4 manipulations.

  • Genome editing in non-model organisms: CRISPR-Cas9 adaptation for Protobothrops species allows precise genetic manipulation of MT-ND4 and associated genes in the native context.

  • Single-cell multi-omics: Integrated analysis of transcriptome, proteome, and metabolome at single-cell resolution reveals cell-to-cell variability in MT-ND4 expression and function.

  • Artificial intelligence for data integration: Machine learning approaches identify complex patterns in high-dimensional datasets linking MT-ND4 variants to functional outcomes.

  • Organoid systems: Three-dimensional tissue models incorporating MT-ND4 variants provide physiologically relevant environments for functional studies.

How does MT-ND4 contribute to mitochondrial DNA maintenance and replication?

Emerging evidence suggests MT-ND4 has functions beyond its canonical role:

  • Nucleoid association: MT-ND4 may physically associate with mitochondrial DNA nucleoids, potentially influencing DNA packaging and protection.

  • Replication machinery interaction: The alternative reading frame product of MT-ND4 might interact with mitochondrial DNA replication machinery, similar to how ARIP-4 DNA helicase in C. elegans couples mitochondrial surveillance to downstream pathways .

  • Transcriptional feedback: MT-ND4 expression levels may feed back to regulate mitochondrial gene transcription, creating a responsive system that maintains appropriate stoichiometry of respiratory complex components.

  • Stress response coordination: Under conditions of mitochondrial stress, MT-ND4 might participate in signaling pathways that adjust mitochondrial DNA replication rates, similar to pathways coupling mitochondrial dysfunction to detoxification responses in C. elegans .

  • Alternative reading frame contributions: The discovery that MT-ND4 contains alternative reading frames producing functional proteins suggests these products may have distinct roles in mitochondrial DNA maintenance, potentially explaining previously unrecognized phenotypes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.