Recombinant Protochlamydia amoebophila ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression system:

  • Host: Escherichia coli

  • Tag: N-terminal hexahistidine (His-tag) for affinity purification .

Protocol:

  1. Cloning: Full-length atpB cloned into pET-based vectors .

  2. Induction: IPTG-induced expression in E. coli BLR or Rosetta2 strains .

  3. Purification: Nickel-affinity chromatography under denaturing/native conditions .

Functional Insights

Role in ATP synthase:

  • Proton translocation: Forms part of the F0 rotor, facilitating proton flow across membranes to drive ATP synthesis in the F1 sector .

  • Coupling mechanism: Interaction with subunit c (c-ring) enables rotational catalysis .

Biological context in P. amoebophila:

  • Energy parasitism: P. amoebophila lacks complete nucleotide biosynthesis pathways and relies on host ATP .

  • ATP/ADP transporters: PamNTT1 imports host ATP, while ATP synthase regenerates ATP via oxidative phosphorylation . Recombinant atpB enables dissection of this energy-recycling mechanism .

Research Applications

Key studies:

  1. Structural biology: Used in cryo-EM studies to resolve ATP synthase architecture in Chlamydiae .

  2. Functional assays: Reconstituted in proteoliposomes to measure proton conductance and ATPase activity .

  3. Host-pathogen interactions: Elucidates how P. amoebophila exploits host energy pools .

Comparative data:

FeatureP. amoebophila atpBMitochondrial atpB
Proton channel residuesConservedDivergent
Membrane orientationInward (F0 sector)Matrix-facing
Transport couplingH+ gradient-drivenΔψ-dependent

Technical Considerations

Limitations:

  • Solubility: Requires detergents (e.g., DDM) for extraction due to hydrophobic transmembrane domains .

  • Activity assays: Functional reconstitution necessitates liposomal systems with subunit c .

Optimization strategies:

  • Truncation of non-essential termini improves yield in E. coli .

  • Co-expression with chaperones (e.g., GroEL/ES) enhances folding .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. If you have a preferred format, please indicate it when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for precise delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag preference, please inform us, and we will prioritize the development of that tag type.
Synonyms
atpB; pc1674; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Protochlamydia amoebophila (strain UWE25)
Target Names
atpB
Target Protein Sequence
MIMGQYLFWLANAHEPIENRIPELPNFISVLYHRFQHTTWAQFLHRWENIIFAILVASLI SLVAYLGARKKEIIPSKFQNLLEIAVEKFSHLILEVLGPEGKAYIPFLGTLFIYIFTMNI FGMVPLMKAPSSSLNITAALAICVFCLVQFLNIRNMGIFGFLYHLAGSPKSMLEWLLAPL MFSLEIISQLSRPLTLALRLFGNVLGEDILIGTFALMGVVMISSVETFVGIPLQLPFMFL GLLTSFMQALVFTLLSTVYILLSMHKEGEKN
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: pcu:pc1674

STRING: 264201.pc1674

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Protochlamydia amoebophila?

ATP synthase subunit a (atpB) in Protochlamydia amoebophila functions as a critical component of the F₀ portion of F₁F₀-ATP synthase, forming part of the membrane-embedded proton channel. This subunit is essential for the translocation of protons across the membrane, which drives the rotational movement of the enzyme complex. In Protochlamydia amoebophila, this process is particularly important as the organism exists as an obligate intracellular symbiont with specific energy requirements. The proton gradient facilitated by atpB ultimately enables ATP synthesis, providing energy for the organism's metabolic processes within its host cell environment . Unlike free-living bacteria, intracellular bacteria like Protochlamydia amoebophila often have specialized ATP acquisition mechanisms, which makes understanding the function of atpB particularly relevant to comprehending the organism's energy parasitism or symbiotic relationship.

Why is the study of recombinant atpB from Protochlamydia amoebophila important for understanding bacterial energy metabolism?

Studying recombinant atpB from Protochlamydia amoebophila provides critical insights into specialized adaptations of energy metabolism in obligate intracellular bacteria. As Protochlamydia exists exclusively within host cells, its ATP synthase components, including atpB, likely reflect evolutionary adaptations to this restricted ecological niche. Recombinant expression allows researchers to investigate these specialized features without the complications of cultivating this fastidious organism. Additionally, Protochlamydia amoebophila represents an evolutionary intermediate between environmental chlamydiae and pathogenic species, making its energy transduction mechanisms particularly informative for understanding the evolution of energy parasitism in bacterial pathogens . Furthermore, since ATP synthase is a potential target for antimicrobial development, characterizing unique features of atpB in Protochlamydia could inform novel therapeutic strategies against related pathogenic chlamydiae. The study of this protein also contributes to our understanding of how obligate intracellular bacteria balance energy acquisition with host cell survival.

What post-translational modifications occur in atpB of Protochlamydia amoebophila and how do they regulate ATP synthase activity?

Post-translational modifications (PTMs) of ATP synthase subunit a (atpB) in Protochlamydia amoebophila likely play crucial roles in regulating ATP synthase activity and adapting to changing intracellular environments. Current research suggests phosphorylation may be particularly important, similar to observations in other bacterial systems where N-terminal phosphorylation of ATP synthase subunits affects assembly and function of the complex. In related systems, phosphorylation at serine residues (such as S8 and S13 in other bacterial ATP synthase components) has been shown to impact ATP synthase accumulation during complex assembly . For Protochlamydia amoebophila, these modifications may serve as regulatory mechanisms to adjust ATP production based on metabolic demands or host cell conditions. Other potential PTMs include acetylation, methylation, and glycosylation, though these remain less characterized. Investigating these modifications requires advanced proteomic approaches such as mass spectrometry, phosphoproteomics, and site-directed mutagenesis to create phosphomimetic mutants. Understanding these regulatory mechanisms provides insight into how this obligate intracellular bacterium fine-tunes its energy production in response to host cell conditions.

How does the interaction between atpB and nucleotide carrier proteins affect energy metabolism in Protochlamydia amoebophila?

The interaction between ATP synthase subunit a (atpB) and nucleotide carrier proteins in Protochlamydia amoebophila represents a sophisticated integration of energy production and nutrient acquisition systems. Protochlamydia amoebophila possesses multiple nucleotide transporter (NTT) proteins that facilitate the exchange of ATP/ADP (PamNTT1), transport RNA nucleotides (PamNTT2), and remarkably, transport intact NAD+ (PamNTT4) . These transport systems likely function in concert with ATP synthase to maintain optimal intracellular nucleotide pools. Research suggests that the spatial organization of these components may create localized energy transfer networks within the bacterial cell, optimizing ATP utilization. The regulatory cross-talk between atpB function and NTT activity may involve shared sensing mechanisms responding to energy status or host cell conditions. Experimental approaches to investigate these interactions include co-immunoprecipitation, bacterial two-hybrid systems, and fluorescence resonance energy transfer (FRET) to visualize protein-protein interactions in situ. Functional assays measuring ATP synthesis in the presence of varying NTT expression levels can further elucidate these relationships. Understanding this integrated system is essential for comprehending how Protochlamydia amoebophila maintains energy homeostasis within its host.

What evolutionary adaptations have occurred in the atpB gene of Protochlamydia amoebophila compared to free-living bacteria and pathogenic chlamydiae?

The atpB gene of Protochlamydia amoebophila exhibits evolutionary adaptations that reflect its position as an evolutionary intermediate between environmental and pathogenic chlamydiae. Comparative genomic analyses reveal that while the core functional domains of atpB remain conserved, Protochlamydia shows specific sequence variations that likely represent adaptations to its endosymbiotic lifestyle. These adaptations may include modifications to optimize ATP synthase function at the lower ATP/ADP ratios typical of host cell environments. Unlike free-living bacteria that predominantly rely on oxidative phosphorylation, Protochlamydia, similar to pathogenic chlamydiae, appears to have evolved a mixed strategy combining ATP synthesis with direct ATP acquisition from the host . This is evidenced by the presence of specialized ATP/ADP translocases alongside a functional ATP synthase complex. Molecular phylogenetic analyses using both atpB and other genetic markers (similar to approaches used with plastid atpB and rbcL genes in plant studies) can reveal the evolutionary trajectory of this gene in chlamydial lineages . Positive selection analyses may identify specific amino acid positions under selection pressure, providing insights into functionally important residues that have adapted to intracellular life. These evolutionary insights are crucial for understanding the transition from environmental bacteria to host-adapted organisms.

What are the optimal conditions for expressing recombinant Protochlamydia amoebophila atpB in Escherichia coli?

Optimal expression of recombinant Protochlamydia amoebophila atpB in Escherichia coli requires careful consideration of several parameters to ensure proper folding and functionality of this membrane protein. Based on successful heterologous expression of other Protochlamydia membrane proteins, a recommended approach would include:

Expression System Parameters:

ParameterRecommended ConditionRationale
E. coli strainC41(DE3) or C43(DE3)Strains engineered for membrane protein expression
Expression vectorpET system with T7 promoterControllable expression with IPTG induction
Fusion tagsN-terminal His₆ tag with TEV cleavage siteFacilitates purification with minimal impact on structure
Induction conditions0.1-0.5 mM IPTG at 18-22°C for 16-20hSlow expression promotes proper folding
Media compositionTerrific Broth supplemented with 1% glucoseProvides nutrients while suppressing leaky expression

The addition of membrane-stabilizing agents such as glycerol (5-10%) to the culture medium can enhance the proper folding of atpB. For purification, a combination of detergent screening (typically starting with mild detergents like DDM or LMNG) is essential to maintain protein stability. Validation of proper folding can be assessed through circular dichroism spectroscopy to confirm secondary structure elements characteristic of ATP synthase subunit a . This methodological approach has proven successful for related membrane proteins from intracellular bacteria and can be modified based on initial expression trials.

What are the most effective methods for assessing the functionality of recombinant atpB in reconstituted systems?

Assessing the functionality of recombinant atpB from Protochlamydia amoebophila in reconstituted systems requires specialized approaches that evaluate both its assembly into the ATP synthase complex and its contribution to proton translocation and ATP synthesis. A comprehensive functional assessment would include:

  • Reconstitution into liposomes or nanodiscs containing other ATP synthase subunits, using a lipid composition mimicking the bacterial membrane.

  • Proton translocation assays using pH-sensitive fluorescent dyes like ACMA or pyranine to monitor ΔpH formation across the membrane.

  • ATP synthesis measurements coupling proton gradient dissipation to ATP production, quantified via luciferin-luciferase luminescence assays.

  • Site-directed mutagenesis of conserved residues involved in proton translocation to validate function, particularly targeting the essential arginine residue typically found in transmembrane helix 4 of subunit a.

  • Crosslinking studies with other ATP synthase subunits to confirm proper assembly and structural interactions within the complex .

A particular challenge with atpB is its hydrophobicity and tendency to aggregate. Successful functional reconstitution often requires co-expression with other ATP synthase subunits or careful optimization of detergent:lipid ratios during reconstitution. The incorporation of fluorescence resonance energy transfer (FRET) pairs in strategic positions can also provide information about conformational changes during the catalytic cycle, offering insights into the dynamic aspects of atpB function within the ATP synthase complex.

How can molecular dynamics simulations contribute to understanding atpB function in Protochlamydia amoebophila?

Molecular dynamics (MD) simulations provide valuable insights into the structure-function relationships of ATP synthase subunit a (atpB) in Protochlamydia amoebophila, particularly in the absence of high-resolution structural data. These computational approaches can elucidate:

  • The conformational dynamics of transmembrane helices during proton translocation, revealing how specific amino acid residues facilitate proton movement through the half-channels characteristic of ATP synthase subunit a.

  • The interaction interfaces between atpB and other subunits, particularly the c-ring, which is essential for converting proton movement into rotational force.

  • The impact of the membrane environment on atpB function, including lipid-protein interactions that may stabilize specific conformations.

  • The effects of point mutations or post-translational modifications on protein dynamics and function, particularly phosphorylation events that may regulate activity .

Implementing effective MD simulations requires first generating a reliable structural model of Protochlamydia amoebophila atpB using homology modeling based on structurally characterized ATP synthase complexes, such as those from E. coli or mycobacteria. The model should then be embedded in a lipid bilayer with appropriate composition and simulated for sufficient time (typically microseconds) to capture relevant dynamics. Analysis should focus on hydrogen-bonding networks, water wire formation in the proton channel, and conformational changes in response to protonation state changes of key residues. These simulations can generate testable hypotheses about critical residues and mechanisms that can subsequently be validated through site-directed mutagenesis and functional assays.

How can one design experiments to investigate the role of atpB phosphorylation in ATP synthase assembly?

Designing experiments to investigate the role of atpB phosphorylation in ATP synthase assembly requires a multifaceted approach combining molecular genetics, biochemistry, and advanced imaging techniques. Based on studies of ATP synthase phosphorylation in related systems, the following experimental design is recommended:

  • Phosphorylation site identification:

    • Perform mass spectrometry-based phosphoproteomics of purified ATP synthase complexes from Protochlamydia amoebophila.

    • Analyze sequence conservation with known phosphorylated residues in other bacterial ATP synthases, particularly focusing on serine residues homologous to S8 and S13 positions identified in other systems .

  • Mutational analysis:

    • Create recombinant atpB constructs with phosphodeficient (serine to alanine) and phosphomimetic (serine to aspartic acid) mutations at identified sites.

    • Express these variants in a heterologous system (E. coli) alongside other ATP synthase subunits.

  • Assembly assessment:

    • Perform blue native PAGE to compare ATP synthase complex formation efficiency.

    • Use sucrose gradient ultracentrifugation to isolate and quantify fully assembled complexes versus unassembled subunits.

    • Implement pulse-chase experiments with radioactively labeled amino acids to track the kinetics of assembly.

  • Structural integrity analysis:

    • Apply hydrogen-deuterium exchange mass spectrometry to assess structural differences between wild-type and mutant atpB within the assembled complex.

    • Use chemical crosslinking followed by mass spectrometry to map interaction interfaces.

  • Functional correlation:

    • Reconstitute purified complexes into liposomes and measure ATP synthesis rates.

    • Correlate assembly efficiency with functional capacity to determine the impact of phosphorylation on both assembly and activity.

This comprehensive approach would provide insights into how phosphorylation events regulate ATP synthase assembly in Protochlamydia amoebophila, potentially revealing regulatory mechanisms specific to intracellular bacteria .

What approaches can be used to study the interaction between atpB and other ATP synthase subunits in Protochlamydia amoebophila?

Studying interactions between ATP synthase subunit a (atpB) and other ATP synthase subunits in Protochlamydia amoebophila requires specialized techniques that can capture both stable and transient protein-protein interactions within this membrane-embedded complex. A comprehensive investigation would include:

  • Genetic fusion approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid), where atpB and potential interaction partners are fused to adenylate cyclase fragments.

    • Split-GFP complementation assays, where fragments of fluorescent proteins are fused to atpB and other subunits, generating fluorescence upon interaction.

  • Biochemical cross-linking:

    • Chemical cross-linking using bifunctional reagents with varying spacer lengths to capture interactions at different distances.

    • Site-specific photo-crosslinking by incorporating unnatural amino acids at predicted interaction sites within atpB.

    • Analysis of crosslinked products by mass spectrometry to identify interaction interfaces at amino acid resolution.

  • Biophysical methods:

    • Förster resonance energy transfer (FRET) between fluorescently labeled subunits to measure distances and dynamics of interactions.

    • Surface plasmon resonance (SPR) with immobilized atpB to measure binding kinetics with other subunits.

    • Hydrogen-deuterium exchange mass spectrometry to identify regions of atpB protected from solvent upon binding to other subunits.

  • Structural biology approaches:

    • Cryo-electron microscopy of reconstituted ATP synthase complexes to visualize the arrangement of subunits.

    • Solid-state NMR spectroscopy to identify specific residues at interaction interfaces.

  • Computational predictions validated by experimentation:

    • Molecular docking and molecular dynamics simulations to predict interaction interfaces.

    • Validation of predictions through site-directed mutagenesis of predicted interface residues followed by functional assays.

These approaches, particularly when used in combination, can provide a comprehensive understanding of how atpB interacts with other ATP synthase subunits, which is essential for defining the unique features of ATP synthase assembly and function in Protochlamydia amoebophila .

How can genetic manipulation systems be developed for studying atpB function directly in Protochlamydia amoebophila?

Developing genetic manipulation systems for studying atpB function directly in Protochlamydia amoebophila presents significant challenges due to its obligate intracellular lifestyle, but recent advances in microbial genetics offer promising approaches:

  • Adaptation of transformation methods:

    • Electroporation of host cells containing Protochlamydia using conditions that temporarily permeabilize both host and bacterial membranes.

    • Development of specialized shuttle vectors containing both Protochlamydia and host cell replication origins.

    • Utilizing the natural competence system, if present in Protochlamydia, by identifying conditions that induce DNA uptake.

  • CRISPR-Cas9 based genome editing:

    • Delivery of CRISPR-Cas9 components targeting atpB via specialized vectors or cell-penetrating peptides.

    • Design of homology-directed repair templates to introduce specific mutations in atpB.

    • Use of Cas9 nickase variants to reduce off-target effects in the small Protochlamydia genome.

  • Conditional gene expression systems:

    • Development of tetracycline-inducible promoter systems adapted for Protochlamydia.

    • Creation of temperature-sensitive atpB variants to allow conditional function.

    • Implementation of riboswitch-based control of atpB expression for tuneable regulation.

  • Transposon mutagenesis approaches:

    • Adaptation of Tn5 or Himar1 transposon systems for random mutagenesis in Protochlamydia.

    • Development of selectable markers functional in the intracellular environment.

    • Creation of transposon libraries followed by selection for atpB function.

  • Host cell line development:

    • Engineering amoeba host cell lines expressing modified atpB variants under inducible control.

    • Using RNA interference in host cells to modulate expression of factors that interact with bacterial ATP synthase.

While direct genetic manipulation of Protochlamydia amoebophila remains challenging, these approaches offer potential routes to study atpB function in its native context. The development of such systems would represent a significant advancement in the field, as currently, most studies rely on heterologous expression systems due to the lack of genetic tools for direct manipulation of obligate intracellular bacteria .

How should researchers interpret discrepancies between in vitro and in silico studies of atpB function?

Researchers encountering discrepancies between in vitro and in silico studies of ATP synthase subunit a (atpB) function should approach these differences through a systematic analytical framework:

  • Evaluation of model assumptions:

    • Assess whether the computational models adequately represent the lipid environment of Protochlamydia membranes.

    • Examine if the homology models used for in silico studies sufficiently capture the unique structural features of Protochlamydia atpB.

    • Consider whether force fields used in simulations appropriately represent the electrostatic environment of the proton channel.

  • Analysis of experimental conditions:

    • Determine if detergents used for protein purification in vitro may have altered the native structure or function of atpB.

    • Evaluate whether the reconstituted system includes all necessary components for full functionality.

    • Consider if the artificial proton gradients applied in vitro accurately mimic physiological conditions inside amoeba hosts.

  • Reconciliation strategies:

    • Implement iterative refinement where in silico predictions inform new in vitro experiments, and experimental results improve computational models.

    • Develop hybrid approaches that incorporate experimental constraints (from techniques like EPR spectroscopy or FRET measurements) into computational models.

    • Utilize ensemble approaches that consider multiple possible conformational states rather than single structures.

  • Statistical validation:

    • Apply statistical methods to determine if discrepancies fall within expected experimental or computational error ranges.

    • Perform sensitivity analyses to identify which parameters most strongly influence the discrepancies.

    • Implement Bayesian approaches to update model confidence based on experimental data.

When substantial discrepancies persist, researchers should consider fundamental differences between the highly controlled in vitro environment and the complex intracellular environment where Protochlamydia atpB naturally functions. The resolution of such discrepancies often leads to new insights about context-dependent protein function and can reveal important regulatory mechanisms that may not be apparent in either approach alone .

What bioinformatic approaches can identify functional domains unique to Protochlamydia amoebophila atpB?

Identifying functional domains unique to Protochlamydia amoebophila ATP synthase subunit a (atpB) requires sophisticated bioinformatic approaches that can detect subtle sequence and structural patterns distinguishing it from homologs in other organisms:

  • Comparative sequence analysis:

    • Multiple sequence alignment of atpB sequences across diverse bacterial taxa, with particular focus on other intracellular bacteria and chlamydiae.

    • Calculation of site-specific evolutionary rates to identify regions evolving under different constraints in Protochlamydia.

    • Application of methods like DIVERGE or ConSurf to identify type II functional divergence (shifts in evolutionary rates at specific sites).

  • Motif identification and analysis:

    • Utilization of motif discovery algorithms like MEME or GLAM2 to identify sequence patterns unique to Protochlamydia atpB.

    • Implementation of hidden Markov models to build profiles of Protochlamydia-specific sequence features.

    • Application of discriminative motif discovery to find sequences that specifically distinguish Protochlamydia atpB from close relatives.

  • Structural bioinformatics approaches:

    • Homology modeling based on available ATP synthase structures, focusing on regions with sequence divergence.

    • Molecular dynamics simulations to identify functionally important conformational dynamics.

    • Analysis of coevolutionary patterns using methods like direct coupling analysis (DCA) or mutual information analysis to predict structurally and functionally important residue interactions.

  • Network analysis:

    • Construction of residue interaction networks to identify clusters of functionally linked amino acids.

    • Comparison of network topology between Protochlamydia atpB and homologs to identify unique connectivity patterns.

  • Integration with experimental data:

    • Mapping of available mutagenesis data onto sequence and structural models.

    • Integration of proteomic data identifying post-translational modifications.

    • Incorporation of crosslinking data to validate predicted interaction interfaces.

This multi-layered approach can reveal functional domains that may be adapted to Protochlamydia's unique ecological niche as an intracellular organism, potentially identifying targets for further experimental investigation or antimicrobial development .

How can structural and functional data be integrated to develop a comprehensive model of atpB operation in Protochlamydia amoebophila?

Developing a comprehensive model of ATP synthase subunit a (atpB) operation in Protochlamydia amoebophila requires sophisticated integration of structural and functional data across multiple scales. An effective integration framework would include:

  • Multi-scale structural modeling:

    • Start with primary sequence analysis to identify conserved and variable regions compared to other bacterial atpB sequences.

    • Build homology models based on available ATP synthase structures, with refinement based on Protochlamydia-specific features.

    • Incorporate data from molecular dynamics simulations to capture conformational flexibility.

    • Validate structural predictions using low-resolution experimental data such as crosslinking distances or EPR measurements.

  • Functional data mapping:

    • Overlay mutagenesis data onto the structural model, highlighting residues critical for proton translocation.

    • Incorporate post-translational modification sites, particularly phosphorylation positions that affect function .

    • Map electrophysiological measurements of proton conductance to specific structural elements.

    • Correlate ATP synthesis rates with structural features to identify rate-limiting components.

  • Temporal dynamics integration:

    • Develop kinetic models of the ATP synthesis cycle incorporating rate constants derived from experimental measurements.

    • Use Markov state models to connect structural transitions to functional states.

    • Implement coarse-grained simulations to capture longer timescale dynamics relevant to the complete catalytic cycle.

  • Environmental context incorporation:

    • Model the lipid environment of the Protochlamydia membrane and its effects on atpB function.

    • Consider the impact of the intracellular pH and ion concentrations characteristic of amoeba hosts.

    • Include interactions with nucleotide transporter proteins that may form functional complexes with ATP synthase .

  • Model validation and refinement:

    • Design experiments specifically to test model predictions.

    • Implement Bayesian inference approaches to update model parameters based on new experimental data.

    • Develop metrics to quantitatively assess model quality and predictive power.

This integrated approach would yield a dynamic, context-aware model of atpB function that captures both structural details and functional properties across multiple temporal and spatial scales. Such a model would provide insights into the unique adaptations of ATP synthase in Protochlamydia amoebophila to its intracellular lifestyle and could inform strategies for targeting similar systems in related pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.