Recombinant Protochlamydia amoebophila ATP synthase subunit c (atpE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpE; pc1673; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Protochlamydia amoebophila (strain UWE25)
Target Names
atpE
Target Protein Sequence
MHLARNPALKSIYIKIRKRKTMSIGTALALSAPFAVGLAALGSGLGLGRAVSSAMEAIGR QPEASGKILTTMIIGAALIEALTIYALIVFFVVLEKMA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit plays a direct role in transmembrane translocation. A homomeric c-ring of 10-14 subunits forms the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links

KEGG: pcu:pc1673

STRING: 264201.pc1673

Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protochlamydia amoebophila and why is it significant for research?

Protochlamydia amoebophila is an obligate intracellular bacterium belonging to the Chlamydiales order. It was originally identified as an endosymbiont of free-living amoebae, specifically Acanthamoeba species. This organism is significant for research for several reasons. First, it represents an evolutionary link between environmental chlamydiae and pathogenic chlamydial species. Second, it exhibits a characteristic developmental cycle similar to pathogenic chlamydiae, transitioning between infectious elementary bodies (EBs) and replicative reticulate bodies (RBs) .

P. amoebophila has been particularly valuable for studying host-pathogen interactions due to its relationship with amoeba hosts. Recent research suggests that some Protochlamydia species, such as P. naegleriophila, may be associated with human diseases like pneumonia, which further enhances their significance in medical research . The study of Protochlamydia offers insights into chlamydial biology, evolution, and potential pathogenicity mechanisms that might be shared with human pathogens.

Additionally, the complete genome sequence of P. amoebophila has revealed unique adaptive features that enable it to thrive within eukaryotic host cells, making it an excellent model system for studying intracellular bacterial lifestyles and host adaptation strategies.

What is the function of ATP synthase in bacterial systems and what makes the P. amoebophila complex unique?

ATP synthase is a critical enzyme complex found in virtually all living organisms, serving as the primary machinery for ATP synthesis through oxidative phosphorylation. In bacteria, this molecular machine consists of two main functional domains: the membrane-embedded F₀ sector that facilitates proton translocation across the membrane, and the cytoplasmic F₁ sector that catalyzes ATP synthesis or hydrolysis .

The distinctive feature of ATP synthase is its rotary mechanism, where proton flow through F₀ drives the rotation of central stalk components, which in turn induces conformational changes in catalytic sites located in F₁, leading to ATP synthesis from ADP and inorganic phosphate (Pi) . The catalytic sites of ATP synthase contain conserved residues including αPhe-291, αSer-347, αGly-351, αArg-376, βLys-155, βArg-182, βAsn-243, and βArg-246 that are crucial for interaction with phosphate groups .

What makes P. amoebophila ATP synthase particularly interesting is its role in the organism's biphasic metabolism during infection. Research has revealed that during the initial stages of infection, P. amoebophila relies on energy parasitism, essentially exploiting host cell ATP. Later in the developmental cycle, it switches to endogenous glucose-based ATP production . This metabolic flexibility represents a unique adaptation to the intracellular lifestyle and likely contributed to the evolutionary success of chlamydial organisms.

Additionally, ATP synthase has been identified as a promising drug target for various diseases including cancer, tuberculosis, neurodegenerative disorders, and mitochondrial myopathies . This makes understanding the structure and function of ATP synthase components, including those from organisms like P. amoebophila, particularly valuable for therapeutic development.

What is the specific role of subunit c (atpE) within the ATP synthase complex?

Subunit c (encoded by the atpE gene) is a critical component of the F₀ sector of ATP synthase. It forms an oligomeric ring structure embedded in the membrane that serves as the primary proton-conducting element of the complex. This c-ring is directly involved in the conversion of the proton motive force into mechanical rotation, which ultimately drives ATP synthesis .

The structure of subunit c typically consists of two transmembrane alpha-helices connected by a polar loop. Multiple copies of subunit c (typically 8-15 depending on the species) assemble into a ring, with the number of subunits influencing the bioenergetic efficiency of the enzyme. Each subunit c contains a conserved acidic residue (usually aspartate or glutamate) that is essential for proton translocation.

In P. amoebophila, the atpE gene and its protein product are particularly interesting because of their potential role in the organism's adaptation to intracellular life. The protein likely contributes to the biphasic energy metabolism observed during the developmental cycle, where P. amoebophila transitions from energy parasitism (relying on host ATP) to endogenous ATP production .

Understanding the structure and function of P. amoebophila atpE can provide insights into how this obligate intracellular bacterium manages its energy needs within the host cell environment. Additionally, due to the essential nature of ATP synthase for bacterial survival, atpE represents a potential target for antimicrobial development.

What are the optimal expression systems for recombinant P. amoebophila atpE?

The expression of recombinant P. amoebophila atpE presents several challenges due to its hydrophobic nature as a membrane protein and potential toxicity when overexpressed. Based on research with similar proteins, Escherichia coli remains the most commonly used expression system due to its simplicity, rapid growth, and high protein yields. Several E. coli-based expression systems have proven effective for membrane proteins like atpE.

For initial expression trials, BL21(DE3) or its derivatives (such as C41(DE3) and C43(DE3)) are recommended as they were specifically developed for the expression of potentially toxic and membrane proteins. The pET expression system using T7 RNA polymerase often provides high-level expression, though regulation is crucial to prevent toxicity. For atpE specifically, using a tightly regulated promoter system such as the arabinose-inducible pBAD vector might be advantageous.

Temperature optimization is critical, with lower temperatures (16-25°C) typically favoring proper folding of membrane proteins. Additionally, the choice of fusion partners can significantly improve expression and solubility. Common fusion tags for membrane proteins include maltose-binding protein (MBP), thioredoxin (Trx), or SUMO protein.

The inclusion of the intercistronic sequence that naturally occurs upstream of the atpE gene has been shown to greatly enhance translational efficiency . Research has demonstrated that this sequence can improve translation when inserted upstream of various genes, including those foreign to E. coli. Therefore, incorporating this sequence into expression constructs for recombinant P. amoebophila atpE would likely increase protein yields significantly.

How does the intercistronic sequence upstream of atpE affect expression efficiency?

The intercistronic sequence found upstream of the atpE gene plays a crucial role in enhancing translational efficiency. This sequence functions as a translational enhancer, significantly improving the expression of genes positioned downstream of it, even for genes that are foreign to E. coli . This enhancement is not gene-specific but represents a general effect on translational mechanisms.

Research has demonstrated that when this intercistronic sequence is inserted upstream of various genes, it can dramatically improve their expression levels. The mechanism behind this enhancement involves optimizing the interaction between the ribosome and the mRNA transcript. The sequence likely contains elements that facilitate ribosome binding and positioning, thus promoting efficient translation initiation.

Several features of this intercistronic region contribute to its enhancing effect. It may contain structures that prevent the formation of inhibitory secondary structures in the mRNA, thereby making the ribosome binding site more accessible. Additionally, it might contain sequence motifs that enhance ribosome recruitment or affect mRNA stability and longevity in the cell.

For researchers working with recombinant P. amoebophila atpE, incorporating this intercistronic sequence into expression constructs represents a powerful strategy to overcome the typically low expression levels often encountered with membrane proteins. The general rather than gene-specific nature of this enhancement makes it a versatile tool applicable to various experimental contexts beyond just atpE expression.

What purification strategies are most effective for recombinant atpE protein?

Purifying recombinant atpE protein presents significant challenges due to its hydrophobic nature as a membrane protein component of ATP synthase. Based on established protocols for similar proteins, a multi-step purification strategy is recommended for obtaining high-purity atpE suitable for structural and functional studies.

The initial step involves membrane isolation and solubilization. After cell lysis, the membrane fraction containing atpE is separated by ultracentrifugation. For solubilization, mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin are preferred as they effectively solubilize membrane proteins while preserving their native structure. The choice of detergent should be empirically determined, as the optimal detergent may vary depending on the specific application.

Following solubilization, affinity chromatography is typically employed as the primary purification step. If the recombinant atpE contains a histidine tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins is highly effective. Careful optimization of imidazole concentrations in the washing and elution buffers is crucial to minimize non-specific binding while maximizing target protein recovery.

For further purification, size exclusion chromatography (SEC) is recommended to separate the target protein from aggregates and other contaminants based on molecular size. This step also allows for buffer exchange into conditions suitable for subsequent applications.

Table 1: Recommended purification strategies for recombinant atpE protein

Purification StageTechniqueKey ParametersConsiderations
Membrane IsolationDifferential centrifugation100,000 × g, 1 hourBuffer composition critical for membrane stability
SolubilizationDetergent extraction1-2% detergent, 4°C, overnightDDM, LMNG, or digitonin recommended
Primary PurificationIMAC (Ni-NTA)20-500 mM imidazole gradientRequires His-tag on recombinant protein
Secondary PurificationSize exclusion chromatographyFlow rate: 0.5 ml/minCritical for removing aggregates
Quality AssessmentSDS-PAGE, Western blotN/AConfirms purity and identity

Throughout the purification process, maintaining a stable detergent concentration above the critical micelle concentration (CMC) in all buffers is essential to prevent protein aggregation. Additionally, including stabilizing agents such as glycerol (10-20%) can help preserve protein structure and function during purification and storage.

What structural features define P. amoebophila atpE compared to other bacterial ATP synthase c subunits?

The structural features of P. amoebophila ATP synthase subunit c (atpE) reflect both conserved elements essential for ATP synthase function and unique adaptations related to the organism's lifestyle as an obligate intracellular bacterium. While specific structural data for P. amoebophila atpE is limited, comparative analysis with related organisms provides valuable insights.

Like other bacterial c subunits, P. amoebophila atpE likely consists of two transmembrane α-helices connected by a polar loop region. The protein assembles into a ring structure within the membrane, forming the proton-conducting component of the F₀ sector. A critical conserved acidic residue (typically aspartate or glutamate) in the second transmembrane helix is essential for proton translocation during ATP synthesis.

What potentially distinguishes P. amoebophila atpE is its adaptation to the intracellular environment. The protein may contain modifications that reflect the organism's biphasic metabolism, which shifts between energy parasitism and endogenous ATP production during its developmental cycle . These adaptations could include alterations in the proton-binding site or in residues that interact with other ATP synthase subunits.

The genomic context of the atpE gene in P. amoebophila also provides clues about its structural and functional properties. The presence of the unique intercistronic sequence upstream of atpE, which enhances translational efficiency , suggests that high-level expression of this protein is particularly important for the organism's energy metabolism.

Phylogenetic analysis places P. amoebophila in a distinct position compared to other chlamydial species, with sequence similarities that reflect its evolutionary history. Comparative analysis of atpE sequences across chlamydial species reveals conservation patterns that highlight functionally critical residues versus those that have diverged to accommodate specific ecological niches.

How can recombinant atpE be employed for studying inhibitors of ATP synthase?

Recombinant P. amoebophila atpE serves as an excellent tool for studying ATP synthase inhibitors, particularly those targeting the membrane-embedded F₀ sector. This approach is valuable not only for fundamental research on energy metabolism but also for drug development, as ATP synthase is increasingly recognized as a promising target for various therapeutic applications .

The experimental workflow typically begins with the reconstitution of purified recombinant atpE into liposomes or nanodiscs to create a functional membrane environment. For comprehensive inhibitor studies, incorporating additional ATP synthase components to form a functional complex may be necessary. This reconstituted system can then be used for various inhibitor screening and characterization assays.

Several methodologies can be employed to assess inhibitor binding and efficacy. Biochemical assays measuring ATP synthesis or hydrolysis activity in the presence of potential inhibitors provide direct functional readouts. Specifically, ATP hydrolysis can be monitored through coupled enzyme assays tracking the release of inorganic phosphate, while ATP synthesis can be assessed using luciferase-based luminescence assays.

Biophysical approaches offer complementary insights into inhibitor interactions. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities and thermodynamic parameters. For detailed structural information, techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or cryo-electron microscopy can reveal specific binding sites and conformational changes induced by inhibitors.

The use of recombinant atpE is particularly relevant given that several classes of natural compounds target ATP synthase. For instance, certain polyphenols and antimicrobial peptides are known to inhibit ATP synthase activity . These compounds bind at the interface of α/β subunits, potentially affecting the rotation mechanism critical for energy conversion. Understanding these interactions at the molecular level can inform the development of novel antimicrobials, particularly against intracellular pathogens that rely on similar ATP synthase components.

What methods are most effective for assessing the functional integrity of recombinant atpE?

Assessing the functional integrity of recombinant P. amoebophila atpE requires a multi-faceted approach that examines both structural properties and functional capabilities. This comprehensive evaluation is crucial before using the protein for downstream applications such as inhibitor screening or structural studies.

Circular dichroism (CD) spectroscopy serves as a primary method for confirming the secondary structure of purified atpE. For transmembrane proteins like atpE, the CD spectrum typically displays characteristic minima at 208 nm and 222 nm, indicating alpha-helical content. Deviations from expected patterns may suggest improper folding or denaturation during purification. Thermal stability can also be assessed by monitoring CD spectral changes during temperature ramping.

Proton translocation capability, the fundamental function of atpE in ATP synthase, can be evaluated using reconstituted proteoliposomes. By incorporating purified atpE into liposomes and establishing a pH gradient, proton movement can be monitored using pH-sensitive fluorescent dyes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine. Diminished proton translocation ability compared to control samples would indicate compromised functionality.

For more comprehensive functional assessment, reconstitution of atpE with other ATP synthase components to form a minimal functional complex allows for direct measurement of ATP synthesis or hydrolysis activities. ATP synthesis can be monitored in proteoliposomes energized with an artificial proton gradient, while ATP hydrolysis can be assessed through coupled enzyme assays that track phosphate release.

Binding studies with known ATP synthase inhibitors provide another approach to verify functional integrity. Techniques such as microscale thermophoresis (MST) or surface plasmon resonance (SPR) can confirm that recombinant atpE maintains expected binding interactions with ligands such as oligomycin or other c-subunit-specific inhibitors.

Table 2: Methods for assessing functional integrity of recombinant atpE

Assessment TypeMethodMeasured ParameterExpected Result for Functional Protein
Structural IntegrityCircular DichroismSecondary structureStrong α-helical signature (minima at 208 and 222 nm)
Membrane IntegrationFluorescence Microscopy with GFP-fusionMembrane localizationDistinct membrane localization pattern
Proton TranslocationACMA Fluorescence QuenchingProton gradient formationSignificant fluorescence quenching upon energization
Complex FormationNative PAGE/Blue Native PAGEAssociation with other subunitsFormation of higher molecular weight complexes
Inhibitor BindingSurface Plasmon ResonanceBinding kinetics and affinitySpecific binding to known c-subunit inhibitors

How can recombinant P. amoebophila atpE be used for studying host-pathogen interactions?

Recombinant P. amoebophila atpE serves as a valuable tool for investigating the complex dynamics of host-pathogen interactions, particularly in the context of intracellular bacterial infections. This protein plays a crucial role in the organism's energy metabolism and adaptation to intracellular life, making it an excellent model for studying bacterial survival strategies within host cells.

One primary application is examining the biphasic metabolism of P. amoebophila during infection. This organism exhibits a distinctive metabolic pattern, initially relying on energy parasitism by exploiting host ATP and later transitioning to endogenous glucose-based ATP production . By studying recombinant atpE and its interactions with host components, researchers can elucidate the molecular mechanisms underlying this metabolic shift and how it contributes to successful intracellular colonization.

Fluorescently tagged recombinant atpE can be used to track the localization and dynamics of ATP synthase components during different stages of infection. This approach enables real-time visualization of energy-generating machinery throughout the developmental cycle, from initial invasion to replication and release stages. Combined with time-resolved transcriptomic data, this provides insights into how chlamydial energy metabolism adapts to changing host environments.

Immunological studies represent another important application. Purified recombinant atpE can be used to raise specific antibodies for immunolocalization experiments or to investigate whether atpE elicits immune responses in host cells. This is particularly relevant given that some ATP synthase components in certain bacteria are located on the cell surface and may interact directly with host immune factors .

The role of atpE in host cell manipulation can also be explored through protein-protein interaction studies. Techniques such as pull-down assays, co-immunoprecipitation, or proximity labeling with recombinant atpE can identify host factors that interact with this protein, potentially revealing mechanisms by which P. amoebophila modulates host energy metabolism to support its own survival and replication.

What role does atpE play in the biphasic metabolism of P. amoebophila during infection?

The atpE gene product (subunit c of ATP synthase) plays a pivotal role in the unique biphasic metabolism exhibited by P. amoebophila during its developmental cycle within host cells. This metabolic strategy represents a sophisticated adaptation to intracellular life that likely contributed significantly to the evolutionary success of chlamydial organisms .

During the initial stages of infection, P. amoebophila primarily relies on energy parasitism, essentially exploiting the host cell's ATP resources rather than generating its own. In this phase, the expression and activity of ATP synthase components, including atpE, may be downregulated as the bacterium draws energy directly from the host. This strategy allows the pathogen to conserve resources while establishing infection.

As the infection progresses to the replicative phase, a remarkable metabolic shift occurs. P. amoebophila transitions to endogenous glucose-based ATP production, which corresponds with increased expression and activity of ATP synthase components . At this stage, atpE becomes crucial for ATP synthesis, forming part of the proton-conducting channel that drives ATP production through oxidative phosphorylation.

RNA sequencing studies have revealed that this metabolic transition involves coordinated transcriptional changes in both the bacterium and the host. Notably, upregulation of complex sugar breakdown in the amoeba host precedes the P. amoebophila metabolic switch . This suggests a sophisticated interaction where the pathogen may influence host metabolism to prepare for its own metabolic transition.

The biphasic expression pattern of atpE likely reflects its dual roles during infection: initially minimizing energy expenditure while exploiting host resources, and later supporting autonomous energy production during rapid replication. This temporal regulation is part of a broader transcriptional program observed in the chlamydial developmental cycle, with major transcriptional shifts conserved among chlamydial symbionts and pathogens .

How does the translational efficiency of atpE affect ATP synthase assembly and function?

The translational efficiency of atpE has profound implications for ATP synthase assembly and function in P. amoebophila and other bacterial systems. The intercistronic sequence upstream of the atpE gene significantly enhances translational efficiency, suggesting that precise regulation of atpE expression is critical for optimal ATP synthase operation .

ATP synthase assembly requires the coordinated production of multiple subunits in appropriate stoichiometric ratios. The c subunit (encoded by atpE) presents a particular challenge as it forms a multimeric ring structure requiring 8-15 copies depending on the species. Enhanced translational efficiency of atpE through its upstream intercistronic sequence likely ensures adequate production of this subunit to support proper complex assembly. Imbalances in subunit availability can lead to incomplete or dysfunctional enzyme complexes, which would compromise energy metabolism.

The effect of translational enhancement extends beyond simple protein quantity. Proper folding and membrane insertion of hydrophobic proteins like atpE often depend on co-translational events, where the nascent polypeptide interacts with membrane insertion machinery. Efficient translation can promote these co-translational processes, potentially reducing misfolding and aggregation that might otherwise occur with slower translation rates.

In the context of P. amoebophila's biphasic metabolism, the translational regulation of atpE may serve as a control point for modulating ATP synthase activity during different developmental stages. During the transition from energy parasitism to endogenous ATP production, enhanced translation of atpE would support the increased demand for functional ATP synthase complexes.

Experimental evidence from other systems indicates that the intercistronic sequence upstream of atpE is portable, enhancing translational efficiency when placed upstream of heterologous genes, including those foreign to E. coli . This general rather than gene-specific effect suggests a fundamental mechanism involving ribosome recruitment or mRNA structural modifications that optimize translation initiation.

How do the transcriptional dynamics of atpE correlate with the developmental cycle of P. amoebophila?

The transcriptional dynamics of the atpE gene in P. amoebophila exhibit a sophisticated pattern that closely correlates with the organism's developmental cycle and metabolic transitions. RNA sequencing studies have revealed a highly dynamic transcriptional landscape throughout infection, with major shifts in gene expression coordinated with developmental transitions .

During the early stages of infection, when P. amoebophila exists as elementary bodies (EBs) and begins differentiation into reticulate bodies (RBs), atpE transcription is likely maintained at relatively low levels. This corresponds with the energy parasitism phase, where the bacterium primarily relies on host ATP rather than synthesizing its own. The reduced expression of ATP synthase components during this stage is metabolically efficient, allowing the pathogen to conserve resources while establishing infection.

As the infection progresses and P. amoebophila enters the replicative phase, a significant upregulation of atpE and other ATP synthase components occurs. This transcriptional shift coincides with the metabolic transition to endogenous glucose-based ATP production . Time-resolved transcriptomic analyses indicate that this metabolic switch is preceded by changes in host cell gene expression, particularly the upregulation of complex sugar breakdown pathways. This sequential transcriptional programming suggests a coordinated host-pathogen interaction that supports the chlamydial developmental cycle.

The completion of the developmental cycle, marked by the redifferentiation of RBs back to infectious EBs, likely involves another transcriptional shift in atpE expression. As the bacterium prepares for release and subsequent infection, the energy demands and metabolic strategy change again, potentially resulting in altered ATP synthase component expression.

Fluorescence in situ hybridization, DAPI staining, and transmission electron microscopy studies tracking the developmental cycle of P. amoebophila in Acanthamoeba hosts have shown that the complete cycle takes approximately 96 hours . This is slightly longer than what has been reported for chlamydiae infecting humans and animals (which typically complete their cycles in 48-72 hours) but shorter than the 6-15 days observed for some other chlamydial species .

What experimental approaches can resolve contradictory data regarding atpE function in different chlamydial species?

Resolving contradictory data regarding atpE function across different chlamydial species requires a multifaceted experimental approach that integrates various methodologies. The observed contradictions may stem from genuine biological differences between species, variations in experimental conditions, or limitations in current analytical techniques.

Comparative genomics and phylogenetics provide a foundation for understanding evolutionary relationships and functional divergence of atpE across chlamydial species. By analyzing sequence conservation patterns and selection pressures, researchers can identify regions critical for conserved functions versus those that may have evolved species-specific roles. This approach can guide subsequent experimental designs by highlighting the most informative regions for functional studies.

Heterologous expression systems offer a controlled environment for direct functional comparisons. By expressing atpE genes from different chlamydial species in a common host (such as E. coli) under identical conditions, researchers can directly compare properties such as expression levels, protein stability, and ATP synthase activity. The intercistronic sequence upstream of atpE, known to enhance translational efficiency , should be included in these constructs to ensure optimal expression.

Site-directed mutagenesis targeting specific residues that differ between species can pinpoint the molecular basis for functional variations. By systematically swapping amino acids between different chlamydial atpE proteins and assessing the impact on function, researchers can identify critical residues responsible for species-specific behaviors.

Advanced structural biology techniques, including cryo-electron microscopy and X-ray crystallography, can reveal how subtle structural differences in atpE proteins contribute to functional variations. While membrane proteins like atpE present challenges for structural determination, recent technological advances have made these approaches increasingly feasible.

Table 3: Experimental approaches for resolving contradictory data on atpE function

ApproachTechniqueExpected OutcomeAdvantagesLimitations
Comparative GenomicsSequence analysis, PhylogeneticsIdentification of conserved vs. variable regionsProvides evolutionary contextLimited functional insight
Functional GenomicsRNA-seq, ProteomicsExpression patterns across developmental cycleSystems-level viewCorrelative rather than causal
Heterologous ExpressionRecombinant expression in E. coliDirect comparison of protein propertiesControlled environmentMay miss host-specific factors
MutagenesisSite-directed mutagenesisIdentification of functionally critical residuesPrecise modificationLabor-intensive
Structural BiologyCryo-EM, X-ray crystallographyAtomic-level structural detailsMechanistic insightsTechnical challenges with membrane proteins
Native Environment StudiesGenetic manipulation in chlamydiaeIn vivo functional assessmentPhysiologically relevantTechnically challenging in obligate intracellular bacteria

In situ functional studies within the native host environment represent the gold standard for resolving contradictions. While genetic manipulation of obligate intracellular bacteria like chlamydiae has historically been challenging, recent advances in transformation techniques for some chlamydial species offer new opportunities. Developing similar genetic tools for P. amoebophila would enable precise manipulation of atpE in its natural context.

What are the implications of ATP synthase as a drug target in treating Protochlamydia-related infections?

ATP synthase presents a promising target for drug development against Protochlamydia and other chlamydia-related infections, with significant therapeutic potential alongside important considerations that must be addressed in drug design strategies. The essential role of ATP synthase in bacterial energy metabolism, combined with specific structural and functional features of chlamydial ATP synthase, creates opportunities for selective therapeutic intervention.

The biphasic metabolism of Protochlamydia during infection provides two distinct approaches for ATP synthase-targeted therapies. During the initial energy parasitism phase, drugs that inhibit the bacterium's ability to exploit host ATP could disrupt establishment of infection. Alternatively, targeting ATP synthase during the endogenous energy production phase could prevent bacterial replication and persistence . This temporal dimension adds complexity but also offers potential for stage-specific treatments.

Several classes of natural compounds have already demonstrated inhibitory effects on ATP synthase. Dietary polyphenols and certain antimicrobial peptides bind to ATP synthase at specific sites, including the interface of α/β subunits . These natural inhibitors provide valuable structural templates for drug development. Additionally, established antibiotics like efrapeptins, aurovertins, and oligomycins target ATP synthase through different mechanisms: efrapeptins bind at a site extending from the rotor across the central cavity into specific catalytic sites; aurovertins bind to the cleft between nucleotide binding and C-terminal domains of β subunits .

The potential role of Protochlamydia species in human diseases underscores the clinical relevance of these drug development efforts. P. naegleriophila has been detected in bronchoalveolar lavage samples from pneumonia patients, suggesting a possible etiologic role in respiratory infections . The development of specific diagnostic PCR for Protochlamydia has enabled identification of these organisms in clinical samples, facilitating both diagnosis and potential treatment evaluation .

A critical consideration in targeting bacterial ATP synthase is selectivity over the human homolog to minimize toxicity. While ATP synthase is highly conserved across all domains of life, structural differences between bacterial and mammalian enzymes can be exploited for selective inhibition. Detailed structural characterization of P. amoebophila ATP synthase components, including atpE, would significantly advance these drug design efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.