Recombinant Protochlamydia amoebophila NADH-quinone oxidoreductase subunit K (nuoK)

What is the basic structure and sequence of Protochlamydia amoebophila nuoK protein?

Protochlamydia amoebophila NADH-quinone oxidoreductase subunit K (nuoK) is a full-length protein consisting of 99 amino acids. The complete amino acid sequence is:

MDILFSLFISMAMFTFGIIGILIKRNALIVFMCVELMLNAANLLFVAFAAHWGNETGLIWVFFVLVVAAAEAAVGLAIIINMFRSKQVVDVDQYNLLRG

This protein is typically expressed with an N-terminal His-tag when produced recombinantly, which facilitates purification and detection in experimental settings. The protein is hydrophobic in nature, containing transmembrane domains that anchor it within the bacterial membrane, where it functions as part of the NADH-quinone oxidoreductase complex involved in respiratory electron transport .

What are the most effective expression systems for recombinant nuoK production?

The most effective expression system for recombinant Protochlamydia amoebophila nuoK production is Escherichia coli. When expressing nuoK, researchers should consider the following methodological approach:

• Vector selection: Use expression vectors with strong, inducible promoters (such as T7) that include an N-terminal His-tag for purification.

• Host strain optimization: E. coli BL21(DE3) or derivatives are recommended for membrane protein expression .

• Expression conditions: Induce expression at lower temperatures (16-20°C) to prevent formation of inclusion bodies.

• Solubilization methods: Use mild detergents for membrane protein extraction.

The resulting recombinant protein should be purified to greater than 90% homogeneity as determined by SDS-PAGE . After purification, the protein is typically supplied as a lyophilized powder that requires proper reconstitution before experimental use.

How should researchers properly store and reconstitute recombinant nuoK protein?

Proper storage and reconstitution of recombinant nuoK protein is critical for maintaining its activity and structural integrity. The recommended protocol is:

Storage recommendations:

• Store lyophilized protein at -20°C to -80°C upon receipt

• Avoid repeated freeze-thaw cycles

• Working aliquots may be stored at 4°C for up to one week

Reconstitution protocol:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Aliquot for long-term storage at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

How does nuoK contribute to respiratory activity in Protochlamydia amoebophila elementary bodies?

NADH-quinone oxidoreductase subunit K plays a critical role in the respiratory activity of Protochlamydia amoebophila elementary bodies (EBs). Research has demonstrated that:

• Host-independent respiratory activity: P. amoebophila EBs maintain respiratory activity even in host-free conditions, with approximately 51.3% (±4.6) of EBs showing activity after 40 hours of incubation .

• Metabolic stability: The respiratory activity in EBs remains stable in a host-free environment, whereas activity declines more rapidly in reticulate bodies (RBs) .

• Enzymatic function: As part of complex I of the respiratory chain, nuoK participates in electron transfer from NADH to quinones, thus contributing to the proton motive force necessary for ATP synthesis.

Methodologically, respiratory activity can be assessed using fluorescence-based assays with appropriate redox indicator dyes. This respiratory capability suggests that nuoK and associated components form a functional electron transport chain in the infectious stage of P. amoebophila, which may be crucial for maintaining infectivity during the host-free phase of its life cycle .

What role does nuoK play in D-glucose metabolism in host-free conditions?

The nuoK protein, as part of the NADH-quinone oxidoreductase complex, is involved in energy generation during D-glucose metabolism in host-free P. amoebophila elementary bodies. Experimental evidence shows:

• D-glucose uptake: P. amoebophila EBs can import D-glucose under host-free conditions, as demonstrated using the fluorescent analog 2-NBDG. Approximately 47.8% (±1.7) of freshly purified EBs and 53.4% (±3.4) of pre-incubated EBs showed uptake capability .

• Metabolic activity: The proportion of EBs capable of D-glucose uptake correlates closely with the proportion showing respiratory activity, suggesting a functional link between substrate utilization and respiratory chain activity .

• Confirmatory methods: D-glucose uptake can be verified through multiple techniques:

  • Fluorescence-based assays using 2-NBDG

  • Isotope ratio mass spectrometry (IRMS) with 13C-labeled D-glucose

  • Detection of labeled metabolites and CO2 release

This metabolic capability appears to be an active process requiring viable bacteria, as heat-inactivated EBs showed no uptake of 2-NBDG . The ability to utilize D-glucose in the absence of a host suggests that nuoK and related respiratory components may help sustain metabolic activity during transmission between hosts.

Which metabolic pathways in P. amoebophila involve the electron transport chain containing nuoK?

The electron transport chain containing nuoK in P. amoebophila is connected to several key metabolic pathways:

Methodologically, these connections can be studied using:

• Isotope labeling with 13C-glucose followed by mass spectrometry

• Metabolite profiling using ICR/FT-MS and UPLC-MS

• Pathway inhibitor studies to confirm specific routes

• Measurement of CO2 release using IRMS

Understanding the integration of nuoK in these metabolic networks provides insight into how P. amoebophila maintains energy production during different developmental stages.

What mutations in nuoK have been observed during temperature adaptation experiments?

During temperature adaptation experiments with P. amoebophila, specific patterns of mutations affecting respiratory chain components have been observed:

• Mutation characteristics: Nonsynonymous mutations and small indels affecting respiratory components including NADH-quinone oxidoreductase subunits may contribute to temperature adaptation .

• Temporal patterns: Several variants persisted throughout multiple time points and reached high frequencies in the population, suggesting they conferred adaptive advantages under temperature stress .

• Treatment-specific changes: Mutated genes within the same temperature regime showed higher similarity than those between temperature regimes, indicating temperature-specific adaptive responses .

For researchers investigating these mutations, the following methodological approach is recommended:

• Establish replicate populations at different temperatures (20°C, 30°C)

• Conduct regular sample collection over an extended period (e.g., 38 months/510 generations)

• Perform pool sequencing at multiple time points throughout the experiment

• Compare variant frequencies across time points and temperature treatments

• Validate functional effects of identified mutations through targeted mutagenesis

Understanding these adaptive mutations provides insight into how respiratory complexes containing nuoK evolve during temperature stress, potentially facilitating host shifts from protists to endothermic animals.

How does the evolution of nuoK in P. amoebophila compare to related proteins in other Chlamydiales?

The evolution of nuoK in P. amoebophila can be compared to related proteins in other Chlamydiales to understand evolutionary processes in obligate intracellular bacteria:

• Evolutionary constraints: As an obligate intracellular symbiont, P. amoebophila experiences different selective pressures compared to free-living bacteria, affecting the evolution of respiratory components like nuoK .

• Adaptation mechanisms: Temperature adaptation in P. amoebophila appears to involve mutations in respiratory components as part of a trade-off between metabolic efficiency and reduced host burden .

• Comparative genomics: Analysis of nuoK across the Chlamydiales order reveals insights into the evolution of respiratory metabolism during the transition from environmental chlamydiae to animal pathogens.

For researchers studying evolutionary patterns, the recommended methodology includes:

• Comparative genomic analysis of nuoK sequences across Chlamydiales

• Phylogenetic reconstruction to identify selective pressures and evolutionary rates

• Experimental evolution studies under different conditions

• Functional validation of identified sequence variations

This comparative approach provides insight into how respiratory components like nuoK evolved during the pivotal evolutionary leap from protist to endothermic animal hosts, which is critical for understanding the emergence of pathogens from environmental precursors .

What are the optimal methods for purifying P. amoebophila developmental stages for nuoK functional studies?

When studying nuoK function in different developmental stages of P. amoebophila, proper purification of elementary bodies (EBs) and reticulate bodies (RBs) is critical. The optimal methodology includes:

• Density gradient centrifugation: This approach, originally described nearly 50 years ago and now widely applied for Chlamydiaceae, can physically separate developmental forms based on density differences .

• Purification validation:

  • Quantitative evaluation using transmission electron microscopy (TEM)

  • Assessment of fraction purity and contamination levels

  • Verification of developmental stage-specific markers

• Pre-incubation strategy: Pre-incubation of purified bacteria ensures measurement of truly host-free metabolic activity while excluding significant contributions from co-purified RBs or host components .

• Sample handling considerations:

  • Maintain consistent temperature during purification

  • Use appropriate buffers to preserve protein integrity

  • Process samples promptly to minimize degradation

This purification methodology has been successfully optimized for P. amoebophila in previous studies and allows for the differential analysis of nuoK function in distinct developmental stages .

How can researchers effectively design mutation studies to understand nuoK function?

To effectively design mutation studies for understanding nuoK function in P. amoebophila, researchers should consider the following methodological approach:

• Mutation strategy selection:

  • Site-directed mutagenesis targeting conserved residues

  • Random mutagenesis approaches for comprehensive screening

  • Deletion/truncation studies to identify functional domains

• Experimental design elements:

  • Inclusion of multiple replicates (at least 12 per condition)

  • Establishment of appropriate control populations

  • Regular sampling at predetermined intervals

• Phenotypic assessment:

  • Measurement of respiratory activity using fluorescence-based assays

  • Evaluation of D-glucose uptake and metabolism

  • Assessment of bacterial infectivity and host impact

• Genotypic characterization:

  • Pool sequencing at multiple time points

  • Tracking mutation frequencies over time

  • Identification of parallel mutations across replicates

For long-term evolution experiments, researchers should maintain cultures for extended periods (e.g., 38 months/510 generations) with regular transfers to fresh media, allowing sufficient time for mutations to arise and be selected for under different conditions .

What analytical techniques are most appropriate for studying nuoK involvement in metabolic pathways?

To comprehensively study nuoK involvement in P. amoebophila metabolic pathways, researchers should employ a multi-faceted analytical approach:

This combined approach provides comprehensive insights into nuoK function, from its role in respiratory activity to its evolution under different conditions, and allows for a thorough understanding of its integration in bacterial metabolism .