Recombinant Protochlamydia amoebophila UPF0365 protein pc1737 (pc1737)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; pc1737; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Protochlamydia amoebophila (strain UWE25)
Target Names
pc1737
Target Protein Sequence
MSTLLLQNLLENGTEFYFFIFVLAIVLLIILSVIGKFISLWFQAFVSGTPIPLFNIIGMS LRKIPPREIVNARINLYKAGLKDIHVGDLETHYLAGGHVPNVVEALIAADKANIPLDWRR ATAIDLAGRDIKAAVQTSVNPRVIDCPNHGGYITGVAKDGIQLNCRARVTVRTNIAQLVG GATEETIIARVGEGIVSAIGGSDTHKQVLESPQKISKLVLEKGLDSSTAFLILSIDIVEI NLGENIGAKLRTDQAESDIRIAKAEAEKRRTMAVAQEQENLAKVRDMEAKLVEAQAAVPL AMAEAFRSGKLGIMDYQRIQNIQSDTDMRNALAKPDSDKKQN
Uniprot No.

Target Background

Function

Recombinant Protochlamydia amoebophila UPF0365 protein pc1737 (pc1737) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. These FMMs are highly dynamic and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.

Database Links

KEGG: pcu:pc1737

STRING: 264201.pc1737

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How does pc1737 relate to other proteins in Protochlamydia amoebophila?

Protochlamydia amoebophila contains numerous proteins involved in host cell interactions, particularly those associated with the bacterial inclusion membrane. While pc1737 has not been definitively characterized as an inclusion membrane protein, it shares certain structural features with confirmed inclusion membrane proteins (Inc proteins) from the same organism .

The genome-wide survey for proteins with distinctive bi-lobed hydrophobic domains (a hallmark of Inc proteins) in P. amoebophila identified 23 putative Inc proteins, including experimentally confirmed Inc proteins designated as IncA, IncQ, IncR, and IncS . These Inc proteins are situated in the inclusion membrane surrounding the intracellular bacteria and are likely involved in host cell manipulation. While pc1737 was not among the experimentally confirmed Inc proteins in the referenced studies, its classification as a conserved hypothetical protein suggests potential functional significance that merits further investigation.

What expression systems are used for producing recombinant pc1737?

Based on commercial product information, recombinant pc1737 is predominantly expressed in E. coli expression systems . This bacterial expression platform offers several advantages for producing recombinant proteins from prokaryotic organisms:

  • High yield of target protein

  • Rapid growth and expression

  • Well-established purification protocols

  • Cost-effectiveness for research applications

The recombinant protein is typically produced with affinity tags, such as polyhistidine (His) tags, to facilitate purification through immobilized metal affinity chromatography (IMAC) . When designing expression systems for pc1737, researchers should consider:

  • Codon optimization for E. coli expression

  • Selection of appropriate fusion tags based on downstream applications

  • Expression conditions that maximize soluble protein production

  • Purification strategies that maintain protein stability and function

What analytical techniques are recommended for characterizing pc1737?

Characterization of recombinant pc1737 should employ multiple complementary approaches:

Structural Analysis:

  • Circular Dichroism (CD) spectroscopy to determine secondary structure content

  • X-ray crystallography or NMR for high-resolution structural determination

  • Size-exclusion chromatography to assess oligomerization states

Functional Analysis:

  • Protein-protein interaction assays (yeast two-hybrid, pull-down assays, co-immunoprecipitation)

  • Membrane association studies using liposome binding assays

  • Host cell binding assays using fluorescently labeled pc1737

Localization Studies:

  • Immunofluorescence microscopy using specific antibodies against pc1737

  • Immuno-transmission electron microscopy for precise subcellular localization

  • Live-cell imaging with fluorescently tagged pc1737

For immunolocalization studies, researchers should follow protocols similar to those used for confirmed Inc proteins of P. amoebophila, which involved immunization of rabbits with purified protein fragments (excluding hydrophobic domains), followed by immunofluorescence analysis and immuno-transmission electron microscopy .

How can researchers effectively produce antibodies against pc1737?

Production of specific antibodies against pc1737 requires careful antigen design:

  • Antigen Selection: Analyze the pc1737 sequence to identify immunogenic regions using epitope prediction software. For proteins with hydrophobic domains (as is common in membrane-associated proteins), exclude these regions from the antigen design as they can lead to poor specificity.

  • Expression Strategy: Express selected fragments as recombinant fusion proteins with solubility-enhancing tags (e.g., GST, MBP) in E. coli.

  • Purification: Implement a two-step purification process combining affinity chromatography and size-exclusion chromatography to ensure high purity.

  • Immunization Protocol:

    • For polyclonal antibodies: Immunize rabbits or guinea pigs with 100-200 μg of purified antigen using complete Freund's adjuvant for primary immunization and incomplete Freund's adjuvant for boosters .

    • For monoclonal antibodies: Consider mouse or rat immunization followed by hybridoma development.

  • Antibody Validation: Validate antibody specificity through Western blotting against both recombinant pc1737 and native protein from P. amoebophila samples. Test for cross-reactivity with related proteins.

  • Application Optimization: Determine optimal working dilutions for different applications (Western blotting, immunofluorescence, immunoprecipitation).

Studies with other P. amoebophila proteins have demonstrated successful antibody production using these approaches .

What experimental systems can be used to study pc1737 function in host-pathogen interactions?

Investigating the function of pc1737 in host-pathogen interactions requires appropriate experimental systems:

Amoeba Infection Models:

  • Acanthamoeba castellanii or other amoeba hosts naturally infected by P. amoebophila

  • Time-course experiments to monitor pc1737 expression during different infection stages

  • Colocalization studies with host cell markers and other bacterial proteins

Heterologous Expression Systems:

  • Expression of pc1737 in surrogate bacterial systems (e.g., Escherichia coli)

  • Mammalian cell transfection with pc1737 expression constructs to assess effects on host cell processes

  • Yeast expression systems for protein-protein interaction studies

Genetic Manipulation Approaches:

  • RNA interference in P. amoebophila (if technically feasible)

  • CRISPR-Cas9 for targeted mutagenesis

  • Overexpression of pc1737 to assess gain-of-function phenotypes

Biochemical Interaction Studies:

  • Pull-down assays with host cell lysates to identify interacting partners

  • Surface plasmon resonance (SPR) to measure binding kinetics with candidate interactors

  • Crosslinking mass spectrometry to identify protein complexes in situ

How does pc1737 compare to other UPF0365 family proteins across bacterial species?

The UPF0365 protein family represents a group of proteins with conserved structural features but largely unknown functions. Comparative analysis of pc1737 with other UPF0365 family members reveals:

  • Sequence Conservation: pc1737 shares structural motifs with other UPF0365 family proteins, particularly in the predicted membrane-spanning regions.

  • Taxonomic Distribution: UPF0365 family proteins are found across diverse bacterial phyla, including representatives in Verrucomicrobiota , suggesting ancient evolutionary origins.

  • Functional Implications: The conservation of this protein family across evolutionary distant bacteria implies fundamental roles in bacterial physiology that remain to be fully elucidated.

  • Structural Features: Most UPF0365 family proteins, including pc1737, contain predicted transmembrane domains that suggest membrane association functions.

Researchers investigating pc1737 should consider these evolutionary relationships when designing experiments and interpreting results. Functional insights gained from better-characterized UPF0365 family members in other bacterial species may provide valuable hypotheses for testing pc1737 function.

What is the significance of pc1737 in the context of chlamydial evolution?

Protochlamydia amoebophila represents an important evolutionary link in understanding chlamydial biology. As a member of the Parachlamydiaceae family, it shares key features with pathogenic Chlamydiaceae while displaying distinct adaptations for its amoeba host environment .

The study of pc1737 and other conserved proteins from P. amoebophila provides several evolutionary insights:

  • Core Genome Components: Proteins conserved across chlamydial families likely represent core components of the chlamydial lifestyle that evolved before the divergence of pathogenic and environmental chlamydiae.

  • Host Adaptation Mechanisms: Differences in protein function between environmental and pathogenic chlamydiae can reveal host adaptation mechanisms.

  • Virulence Evolution: Comparing pc1737 to related proteins in pathogenic chlamydiae may illuminate the evolution of virulence factors.

  • Symbiosis versus Pathogenesis: P. amoebophila establishes a symbiotic relationship with its amoeba host, in contrast to the pathogenic relationship seen with Chlamydiaceae and their mammalian hosts. The functional characterization of pc1737 could provide insights into the molecular basis of these different host-microbe relationships.

What challenges should researchers anticipate when working with recombinant pc1737?

Researchers working with recombinant pc1737 should anticipate several technical challenges:

Expression and Solubility Issues:

  • The presence of hydrophobic regions may lead to aggregation and inclusion body formation

  • Expression levels may be suboptimal due to codon usage bias

  • Protein folding may not replicate native conformation without proper membrane environment

Purification Complications:

  • Membrane-associated proteins typically require detergents for extraction

  • Multiple purification steps may be necessary to achieve high purity

  • Protein stability in solution may be limited, affecting storage conditions

Functional Assessment Difficulties:

  • Limited knowledge of natural binding partners

  • Lack of established functional assays

  • Potential requirement for specific host factors for activity

Solution Strategies:

  • Use fusion partners that enhance solubility (MBP, SUMO, etc.)

  • Optimize expression conditions (temperature, induction time, media composition)

  • Consider cell-free expression systems for difficult-to-express proteins

  • Implement detergent screening to identify optimal extraction conditions

  • Develop activity assays based on predicted functional domains

How might structural studies of pc1737 inform functional hypotheses?

Structural characterization of pc1737 represents a powerful approach to generate functional hypotheses:

  • Secondary Structure Analysis: Computational predictions based on the amino acid sequence suggest pc1737 contains potential membrane-spanning regions, consistent with a possible role in membrane interactions .

  • Tertiary Structure Determination: While the three-dimensional structure of pc1737 has not been experimentally determined, structural determination through X-ray crystallography or cryo-electron microscopy would reveal:

    • Potential binding pockets for ligands or protein partners

    • Surface-exposed regions that might mediate host interactions

    • Structural homology to proteins of known function

  • Domain Analysis: Identification of conserved domains through structural comparisons could reveal functional modules within pc1737:

    • Signal transduction domains

    • Protein-protein interaction motifs

    • Enzymatic active sites

  • Molecular Dynamics Simulations: Computational simulations of pc1737 in membrane environments could predict:

    • Conformational changes upon membrane insertion

    • Potential oligomerization interfaces

    • Regions accessible for interaction with host or bacterial proteins

What approaches can be used to investigate the potential role of pc1737 in inclusion membrane biology?

Investigation of pc1737's potential role in inclusion membrane biology requires integrative experimental approaches:

Localization Studies:

  • Generate specific antibodies against pc1737 for immunofluorescence microscopy

  • Perform co-localization experiments with confirmed inclusion membrane markers

  • Use immuno-transmission electron microscopy for high-resolution localization

Functional Analysis:

  • Identify host and bacterial protein interaction partners through affinity purification followed by mass spectrometry

  • Assess the effects of pc1737 overexpression or depletion on inclusion formation and stability

  • Investigate the timing of pc1737 expression during the developmental cycle

Comparative Analysis:

  • Compare pc1737 with experimentally confirmed Inc proteins (IncA, IncQ, IncR, IncS) from P. amoebophila

  • Analyze the distribution of pc1737 homologs across the chlamydial phylogenetic tree

  • Evaluate structural similarities with Inc proteins despite potential lack of sequence homology

Based on research with other inclusion membrane proteins in P. amoebophila, similar experimental approaches might be applied to pc1737 to determine its subcellular localization and possible role in host-pathogen interactions .

Physicochemical Properties of pc1737

ParameterValueReference
Length342 amino acids
Molecular Weight37,286.4 Da
Isoelectric Point (pI)6.98
Protein ClassificationConserved hypothetical protein, UPF0365 family
Gene IDpc1737
OrganismProtochlamydia amoebophila strain UWE25
UniProt AccessionQ6MAD8

Comparison of Selected Protochlamydia amoebophila Proteins

ProteinLength (aa)Molecular Weight (Da)pIClassificationInclusion Membrane Localization
pc0156 (IncQ)90335,051.98.88Hypothetical proteinConfirmed
pc0399 (IncA)84095,891.05.61Similar to inclusion protein IncAConfirmed
pc0530 (IncR)---Unknown proteinConfirmed
pc1111 (IncS)---Unknown proteinConfirmed
pc173734237,286.46.98Conserved hypothetical proteinNot determined

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.