Recombinant Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctaB; CE1693; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Target Names
ctaB
Target Protein Sequence
MSGTHQQHADQCKSDFLIATLWRNKPLETIKAYIALTKPRVIELLLVATIPAMLQAERGE HNIILILLTVIGGWMGAAAANTFNMVADSDIDQRMGRTRARPLVKHTVSNRDASIFAWVL TVASFLWLWLLCNSLTAAVFVMITIAFYIFVYTKWLKRRTHMNIVWGGAAGCMPVAVGWA VIVDQFPEGQPQQWWQAIVLFLIIFFWTPPHTWALAMKYREDYKAAGVPMLPVVRTPVQV TRQIVWYSVATVLVTFLLIPAAGWIYAAAAVLAGVAFLWMAIRLHLGIKNGAEVKPLKLF ILSNNYLAVLFLALSVDAVLGIQTIGEMMGWNTTFF
Uniprot No.

Target Background

Function
Protoheme IX farnesyltransferase (CtaB) catalyzes the conversion of heme B (protoheme IX) to heme O. This conversion involves substituting the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (ctaB) and what is its primary function?

Protoheme IX farnesyltransferase (ctaB) is an enzyme involved in the bacterial heme biosynthesis pathway, specifically in the conversion of protoheme IX to heme O through the addition of a farnesyl group. The enzyme catalyzes a critical step in the respiratory chain assembly, facilitating electron transport processes essential for bacterial energy production. In bacterial systems, ctaB functions as part of the cytochrome biosynthesis pathway, which is crucial for cellular respiration and energy metabolism . The enzyme belongs to a larger family of transferases that modify tetrapyrrole structures, with the specific function of adding an isoprenoid tail to the heme molecule, enabling its proper incorporation into membrane-bound cytochromes.

Which bacterial species express functional ctaB and how is it conserved across species?

Functional ctaB is expressed in various bacterial species, with significant presence in Gram-positive bacteria. Notable examples include Staphylococcus aureus (particularly strains like USA500) and Bacillus pseudofirmus, which have been subjects of extensive research . The gene encoding ctaB is relatively conserved across bacterial species, though with variations in regulatory mechanisms. In S. aureus, the ctaB gene is positioned within an operon structure that facilitates coordinated expression with other genes involved in heme biosynthesis and respiratory functions . Comparative genomic analyses suggest that while the core catalytic domain of ctaB remains conserved, the regulatory regions exhibit species-specific adaptations, reflecting the diverse ecological niches occupied by different bacterial species.

How does ctaB contribute to bacterial pigmentation and what are the biochemical mechanisms involved?

The relationship between ctaB and bacterial pigmentation is particularly evident in S. aureus, where deletion of the ctaB gene leads to altered pigment production . The biochemical mechanism involves the interconnection between heme biosynthesis and staphyloxanthin (the golden pigment in S. aureus) production pathways. When ctaB is absent, the disruption in heme biosynthesis creates a metabolic imbalance that affects the isoprenoid precursors shared between heme and staphyloxanthin synthesis pathways . Specifically, the absence of ctaB leads to accumulation of certain metabolic intermediates that would otherwise be consumed in heme O synthesis, consequently altering the flux through the branched isoprenoid pathway that supplies precursors for staphyloxanthin. This metabolic shift explains the observed changes in pigmentation when ctaB is knocked out in S. aureus.

What experimental evidence supports the role of ctaB in bacterial persistence?

Experimental evidence from deletion mutant studies in S. aureus demonstrates a significant association between ctaB and bacterial persistence. When researchers created a ΔctaB mutant in S. aureus USA500, they observed notable changes in the bacteria's ability to form persister cells . Persistence assays, comparing wild-type and ΔctaB mutants exposed to antibiotics, showed altered survival patterns in the mutant strain. The mechanistic explanation involves ctaB's role in maintaining proper respiratory function. Without functional ctaB, bacteria experience altered metabolic states that impact their ability to enter dormancy or low-metabolic states associated with persistence . This connection between respiratory function and persistence provides valuable insights into potential targets for addressing bacterial persistence in clinical settings.

What are the optimal methods for creating ctaB deletion mutants for functional studies?

Creating precise ctaB deletion mutants requires careful genetic manipulation techniques. Based on published methodologies, an effective approach involves using an allelic exchange system such as the pKOR1 vector system . The process begins with amplifying approximately 1000 base pairs upstream and downstream of the ctaB gene using specific primers (e.g., ctaB-uf, ctaB-ur for upstream and ctaB-df, ctaB-dr for downstream fragments). These fragments are then joined via fusion PCR using the outermost primers . The resulting construct is digested with appropriate restriction enzymes (KpnI and MluI in published protocols) and ligated into a modified vector like pMX10, which contains a ccdB element with multiple cloning sites .

The recombinant plasmid is then transformed into the target bacterial strain via electroporation, and mutants are selected through a temperature-sensitive replication mechanism that favors genomic integration. Verification of successful deletion involves PCR confirmation and potentially Southern blot analysis to ensure clean deletion without affecting adjacent genes. For complementation studies, the ctaB gene with its native promoter can be amplified (using primers like cp-ctaB-f and cp-ctaB-r) and cloned into a suitable expression vector such as PRB473 for transformation into the ΔctaB strain .

How can recombinant ctaB be effectively expressed and purified for biochemical studies?

Expressing and purifying functional recombinant ctaB requires consideration of the protein's membrane association and enzymatic nature. A systematic approach begins with selecting an appropriate expression system, with E. coli being commonly used for initial studies due to its well-established genetic tools. The ctaB gene should be codon-optimized for the expression host and cloned into a vector containing an inducible promoter and suitable affinity tag (e.g., His6, GST, or MBP) .

For expression, conditions must be optimized to balance protein yield and solubility. Typical conditions involve growth at lower temperatures (16-25°C) after induction to reduce inclusion body formation. Since ctaB is a membrane-associated enzyme, inclusion of detergents (e.g., n-dodecyl-β-D-maltoside) in the lysis buffer is critical for solubilization. Purification can be achieved through a multi-step process: initial affinity chromatography using the engineered tag, followed by ion exchange chromatography, and finally size exclusion chromatography for highest purity . Throughout the purification process, enzyme activity should be monitored using a protoheme IX substrate and farnesyl pyrophosphate to ensure the retention of catalytic function.

What analytical techniques are most effective for studying ctaB enzymatic activity?

Studying ctaB enzymatic activity requires specialized analytical techniques due to the nature of the reaction catalyzed. High-performance liquid chromatography (HPLC) coupled with UV-visible detection provides a powerful approach for monitoring the conversion of protoheme IX to heme O. The reaction can be set up using purified recombinant ctaB, protoheme IX substrate, farnesyl pyrophosphate, and appropriate buffer conditions (typically pH 7.5-8.0 with divalent cations like Mg²⁺) .

For more detailed kinetic studies, radiometric assays using ¹⁴C-labeled farnesyl pyrophosphate can quantify reaction rates under varying substrate concentrations, enabling determination of kinetic parameters (Km, Vmax). Mass spectrometry techniques, particularly liquid chromatography-mass spectrometry (LC-MS), offer high sensitivity for product identification and quantification. For investigating the enzyme's structure-function relationship, site-directed mutagenesis of conserved residues followed by activity assays can identify critical catalytic and substrate-binding sites. Additionally, advanced biophysical methods like isothermal titration calorimetry (ITC) can provide insights into substrate binding energetics and mechanisms.

How does the absence of ctaB affect bacterial gene expression and metabolic pathways?

The absence of ctaB has profound effects on bacterial gene expression and metabolism, extending beyond the immediate heme synthesis pathway. RNA-sequencing and transcriptomic analysis of ΔctaB mutants compared to wild-type strains reveal significant alterations in expression patterns across multiple metabolic pathways . The primary effect involves upregulation of genes related to alternative respiratory pathways as the bacteria attempt to compensate for disrupted cytochrome function. Additionally, stress response genes show increased expression, indicating that loss of ctaB creates cellular stress conditions .

Metabolomic studies would show accumulation of protoheme IX (the substrate) and reduction in heme O and heme A (the products of the pathway). This metabolic shift creates a cascade effect, altering the balance of electron carriers and consequently affecting ATP production through oxidative phosphorylation. The metabolic disruption extends to iron homeostasis pathways, as heme metabolism is intricately connected to iron utilization. In S. aureus specifically, the metabolic imbalance affects isoprenoid precursor availability, which explains the observed changes in pigmentation in ΔctaB mutants .

What are the structural characteristics of ctaB and how do they relate to function?

While high-resolution structural data for ctaB is limited, structural predictions based on homology modeling and related proteins in the prenyltransferase family provide insights into its functional architecture. The enzyme likely adopts a structure with distinct substrate binding domains – one for the protoheme IX and another for the farnesyl pyrophosphate donor. The catalytic core likely contains conserved aspartate-rich motifs characteristic of prenyltransferases, which coordinate essential divalent metal ions (typically Mg²⁺) that activate the pyrophosphate group for nucleophilic attack .

Transmembrane prediction algorithms suggest that ctaB contains membrane-associated domains, consistent with its function in modifying components of the membrane-bound respiratory chain. The enzyme's structure likely includes a hydrophobic pocket that accommodates the porphyrin ring structure of protoheme IX, positioning it correctly for the farnesyl transfer reaction. Conserved residues across bacterial species can be identified through multiple sequence alignment, highlighting the catalytically essential amino acids that could serve as targets for site-directed mutagenesis studies to further elucidate structure-function relationships.

What experimental approaches can be used to study the interaction between ctaB and other proteins in the heme biosynthesis pathway?

Studying the interaction between ctaB and other proteins in the heme biosynthesis pathway requires multiple complementary approaches. Bacterial two-hybrid systems offer a genetic method to detect protein-protein interactions in vivo, while pull-down assays using tagged ctaB can identify interacting partners from bacterial lysates followed by mass spectrometry identification. Co-immunoprecipitation with antibodies specific to ctaB can isolate native protein complexes from bacterial cells, preserving physiologically relevant interactions .

For visualizing the spatial organization of these interactions, fluorescence microscopy techniques using fluorescently tagged proteins (e.g., GFP-ctaB fusion) can reveal co-localization patterns. More quantitative assessments of interaction strength can be obtained through surface plasmon resonance (SPR) or biolayer interferometry (BLI) using purified proteins. Crosslinking mass spectrometry (XL-MS) provides information about specific contact points between ctaB and its interaction partners, generating detailed structural insights into functional complexes. Additionally, genetic approaches such as synthetic lethality screening can identify genes whose products functionally interact with ctaB, even in the absence of direct physical interactions.

How can understanding ctaB function contribute to antibiotic development strategies?

Understanding ctaB function offers promising avenues for antibiotic development, particularly given its association with bacterial persistence. Research has demonstrated that ctaB deletion in S. aureus affects persister cell formation, suggesting that targeting this enzyme could sensitize bacteria to existing antibiotics . A potential research strategy involves developing small molecule inhibitors that specifically target ctaB's catalytic site, disrupting heme biosynthesis and consequently bacterial respiration. Such inhibitors could be developed through structure-based drug design approaches, utilizing homology models of ctaB to identify potential binding pockets.

The advantage of targeting ctaB lies in its absence from mammalian systems, potentially reducing off-target effects in human cells. Combination therapy approaches could be particularly effective, where ctaB inhibitors are administered alongside conventional antibiotics to prevent persister formation and enhance bacterial clearance. Future research should focus on validating ctaB as a druggable target through in vivo models of infection, as well as developing high-throughput screening assays to identify lead compounds with ctaB inhibitory activity.

What methods can be employed to study the role of ctaB in bacterial biofilm formation?

Investigating ctaB's role in biofilm formation requires a multi-faceted experimental approach. Static biofilm assays comparing wild-type and ΔctaB mutant strains provide quantitative measurements of biofilm-forming capacity. These assays typically involve growing bacteria in microtiter plates, followed by crystal violet staining to quantify attached biomass . For more detailed analysis, confocal laser scanning microscopy of fluorescently labeled bacteria can visualize biofilm architecture and matrix composition in three dimensions.

Flow cell systems offer advantages for studying biofilm development under dynamic conditions that better mimic physiological environments. Transcriptomic analysis of biofilm-grown ΔctaB mutants versus planktonic cultures can identify gene expression changes specific to the biofilm state, providing insights into how ctaB influences the biofilm lifestyle. Metabolomic profiling of biofilms would reveal how ctaB-related metabolic shifts affect extracellular matrix production and composition. For in vivo relevance, animal models of biofilm-associated infections (e.g., catheter-associated infections) comparing wild-type and ΔctaB strains can demonstrate the clinical significance of ctaB in biofilm-related pathogenesis.

How does the function of ctaB differ between pathogenic and non-pathogenic bacterial species?

Comparative genomic and functional analyses reveal important differences in ctaB function between pathogenic and non-pathogenic bacterial species. In pathogenic bacteria like S. aureus, ctaB function is integrated with virulence mechanisms, particularly through its influence on persistence and pigment production . The staphyloxanthin pigment affected by ctaB activity provides protection against host immune defenses, specifically neutrophil-mediated killing through reactive oxygen species. In contrast, non-pathogenic species utilize ctaB primarily for basic respiratory functions without these additional virulence-related roles.

Regulatory mechanisms also differ significantly, with pathogenic species often placing ctaB under the control of global virulence regulators that respond to host environmental cues. This allows for coordinated expression with other virulence factors during infection. Evolutionary analysis of ctaB sequences across bacterial species reveals selection pressures that have shaped its function differently in pathogenic versus non-pathogenic lineages, with pathogenic strains showing evidence of adaptation to the host environment. Experimental approaches to further elucidate these differences include heterologous expression studies, where ctaB from different species is expressed in a common host to assess functional variations.

What are the current technical challenges in studying ctaB and how might they be overcome?

Several technical challenges complicate research on ctaB functionality. The membrane-associated nature of the enzyme presents difficulties for expression and purification, often resulting in protein aggregation or loss of activity . This challenge can be addressed through optimization of solubilization conditions using various detergents or nanodiscs to maintain a native-like membrane environment. The enzyme's dependence on specific lipid environments for optimal activity necessitates careful consideration of reconstitution conditions for in vitro studies.

Another significant challenge involves developing reliable activity assays given the hydrophobic nature of both substrate and product. This can be overcome through development of specialized HPLC methods with appropriate extraction protocols, or through coupled enzyme assays that produce more easily detectable signals. For structural studies, the membrane association has hindered crystallization efforts. Emerging approaches like cryo-electron microscopy combined with lipid nanodiscs offer promising alternatives for structural determination. Additionally, the functional redundancy in some bacterial species complicates phenotypic analysis of single ctaB mutants, necessitating the creation of multiple gene knockouts to fully reveal functional roles.

What are the most promising future research directions for ctaB studies?

The future of ctaB research holds several promising directions with significant scientific and clinical implications. Integration of structural biology approaches with functional studies presents an opportunity to develop a comprehensive understanding of ctaB's catalytic mechanism, potentially enabling rational design of inhibitors. The application of systems biology approaches, combining transcriptomics, proteomics, and metabolomics data from ctaB mutants, could reveal broader impacts of this enzyme on bacterial physiology beyond the immediate heme biosynthesis pathway .

From a clinical perspective, exploring the relationship between ctaB function and antibiotic tolerance presents opportunities for addressing the pressing challenge of bacterial persistence . Development of ctaB inhibitors as adjuvants to conventional antibiotics could enhance treatment efficacy for persistent infections. The role of ctaB in bacterial adaptation to host environments during infection remains incompletely understood and represents an important area for investigation using in vivo infection models. Additionally, comparative studies across diverse bacterial species could reveal evolutionary adaptations of ctaB function that contribute to bacterial fitness in different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.