Recombinant Prunus dulcis Oleosin 1 (OLE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OLE1; Oleosin 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-148
Protein Length
Full Length of Mature Protein
Species
Prunus dulcis (Almond) (Amygdalus dulcis)
Target Names
OLE1
Target Protein Sequence
ADQHFQQPLHFQGSYGQQQPRSYQVAKAATAVTAGGSLLVLSGLVLAGTVIALTIATPLL VIFSPVLVPALITVALITMGFLTSGGFGVAAVTVLSWIYKYVTGKQPPGADQLDQARHKL AGKARDIKDRAEQFGQQHVPSGQQQSS
Uniprot No.

Target Background

Function
Oleosin 1 likely plays a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It probably interacts with both lipid and phospholipid components of lipid bodies and may provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is Prunus dulcis Oleosin 1 and what is its biological function?

Oleosin 1 (OLE1) from Prunus dulcis is a small hydrophobic protein that localizes to the surface of oil bodies in seeds. Like other oleosins, it likely functions to stabilize oil bodies at low water potential and regulate their size during seed development and germination . The protein contains the signature "proline knot" motif (PX5SPX3P) that is conserved across plant oleosins and is critical for proper insertion into the oil body phospholipid monolayer . OLE1 belongs to the S-type oleosin subfamily, as characterized in comparative studies with other plant species including Arabidopsis . The protein plays an important role in seed oil accumulation, with expression levels that correlate strongly with oil deposition during seed development .

How does Prunus dulcis OLE1 compare structurally with oleosins from other plant species?

Prunus dulcis OLE1 shares significant structural similarities with other plant oleosins, particularly those from closely related Rosaceae species. Genome-wide phylogenetic analysis shows that OLE1 represents one of five distinct oleosin subfamilies found across tree species . All contain the highly conserved "proline knot" motif which serves as the structural signature of the oleosin family . Like other oleosins, Prunus dulcis OLE1 is characterized by:

PropertyTypical Value for OLE1Comparison to Other Oleosins
Amino Acid Length~154 amino acidsSimilar to other seed oleosins (150-160aa)
Molecular Weight~16.5 kDaConsistent with S-type oleosins
Isoelectric Point~9.35Higher than average (most oleosins: 8.5-9.5)
Hydrophobic Residues~40.45%Consistent with oil body surface proteins
Secondary StructureCentral hydrophobic domain flanked by amphipathic N/C terminiConserved across plant oleosins

Phylogenetic analysis places Prunus dulcis OLE1 closest to oleosin proteins from other Rosaceae family members, with measurable homology to castor bean (Ricinus communis) oleosins, suggesting evolutionary conservation of structural features critical to oil body formation .

What expression patterns characterize OLE1 during seed development?

OLE1 exhibits a distinct temporal expression pattern during seed development. Studies in related species have demonstrated that OLE1 mRNA levels rapidly increase during seed development, with expression patterns closely coordinated with oil accumulation in the seeds . Research shows that OLE1 is primarily expressed in developing seeds, with much lower expression levels in vegetative tissues like leaves and flowers . Quantitative analysis using both TaqMan and SYBR Green qPCR methods has shown that OLE1, along with OLE2 and OLE3, is expressed at significantly higher levels than OLE4 and OLE5 in developing seeds, suggesting its predominant role in oil body formation .

The expression timing corresponds to the phase of active oil synthesis and accumulation, indicating a functional relationship between OLE1 expression and the development of storage oil reserves in the seed .

What are the optimal expression systems for producing recombinant Prunus dulcis OLE1 for research purposes?

The production of functional recombinant Prunus dulcis OLE1 requires careful consideration of expression systems. Based on protocols developed for similar proteins, E. coli expression systems with appropriate fusion tags have proven effective . For recombinant OLE1 production:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coliHigh yield, cost-effective, rapid growthPossible improper folding, lack of post-translational modificationsN-6His-SUMO tag improves solubility
Yeast (P. pastoris)Proper folding of eukaryotic proteins, post-translational modificationsLower yield, longer expression timeα-factor secretion signal, C-terminal His tag
Plant-based (N. benthamiana)Native-like processing and foldingComplex extraction process, lower yieldGFP fusion for visualization of targeting

The E. coli system using the N-6His-SUMO tag has been successfully employed for similar proteins, providing greater than 90% purity as determined by SDS-PAGE . This approach facilitates both purification and potential enhancement of solubility for the inherently hydrophobic oleosin protein. For structural and functional studies requiring post-translational modifications, yeast or plant-based expression systems may be preferable despite lower yields .

What methodological approaches best characterize the interaction between OLE1 and oil body phospholipid membranes?

Characterizing OLE1 interactions with oil body membranes requires multiple complementary approaches:

  • Biophysical analysis: Surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) can quantify binding affinity between recombinant OLE1 and artificial oil bodies or liposomes with varying phospholipid compositions.

  • Microscopy techniques: Confocal microscopy using fluorescently-tagged OLE1 can visualize localization patterns, while atomic force microscopy can evaluate the topography of OLE1 on membrane surfaces.

  • Reconstitution assays: In vitro reconstitution of artificial oil bodies using purified OLE1 at different protein:lipid ratios allows assessment of:

    • Oil body size regulation

    • Stability under varying pH and ionic conditions

    • Protection against lipase activity

  • Mutagenesis studies: Strategic modifications of the conserved proline knot motif (PX5SPX3P) can determine critical residues for membrane association . Mutations in the hydrophobic domain affect the protein's ability to properly insert into the phospholipid monolayer.

Recent findings suggest that beyond simple physical stabilization, OLE1 may possess enzymatic functions including monoacylglycerol acyltransferase and phospholipase activities, which can be assessed through specific enzymatic assays using the recombinant protein .

How do post-translational modifications affect OLE1 function in oil body biogenesis?

Post-translational modifications (PTMs) are critical regulators of OLE1 function, though this area remains underexplored for Prunus dulcis specifically. Research in related oleosins suggests:

  • Phosphorylation: Evidence indicates that oleosins can be phosphorylated by serine/threonine/tyrosine protein kinases, potentially regulating their enzymatic activities . Analysis of the OLE1 sequence reveals potential phosphorylation sites that may undergo dynamic modification during seed development.

  • Ubiquitination: During seed germination, oleosins are degraded through ubiquitin-mediated proteolysis, enabling oil body breakdown and mobilization of stored lipids. Studying the timing and specificity of OLE1 ubiquitination provides insights into oil mobilization mechanics.

  • Conformational changes: Environmental factors like pH, hydration, and temperature can induce structural changes in OLE1 that affect oil body stability. These conformational shifts may represent a form of regulation distinct from chemical modifications.

Methodologically, studying these modifications requires:

  • Mass spectrometry-based proteomics to identify and map PTMs

  • Phospho-specific antibodies to track phosphorylation states

  • Site-directed mutagenesis to create phosphomimetic variants

  • In vitro kinase assays to identify responsible enzymes

The functional consequences of these modifications can be assessed through oil body reconstitution assays comparing wild-type and modified OLE1 proteins, measuring parameters such as oil body size distribution, resistance to coalescence, and susceptibility to lipase degradation.

What purification strategy yields the highest purity recombinant Prunus dulcis OLE1 protein?

Obtaining high-purity recombinant OLE1 presents challenges due to its hydrophobic nature. Based on protocols developed for similar proteins, a multi-step purification strategy is recommended:

  • Initial capture: Affinity chromatography using Ni-NTA resin for His-tagged OLE1 provides efficient initial purification . For optimal binding, use Tris/PBS-based buffer with 5-50% glycerol to maintain solubility .

  • Tag cleavage: For proteins expressed with the His-SUMO tag, SUMO protease treatment removes the tag while preserving native protein structure . Optimization of cleavage conditions (temperature, time, enzyme:protein ratio) is critical for complete digestion without aggregation.

  • Secondary purification: Size exclusion chromatography separates monomeric OLE1 from aggregates and contaminants. A detergent-containing buffer (0.1% n-dodecyl β-D-maltoside) improves separation quality.

  • Final polishing: Ion exchange chromatography at pH 7.0 (where OLE1 carries a positive charge) provides final purification, achieving >95% purity as assessed by SDS-PAGE.

Purification StepBuffer CompositionCritical ParametersExpected Yield
Ni-NTA Affinity50 mM Tris, 150 mM NaCl, 20 mM imidazole, 10% glycerol, pH 8.0Flow rate: 0.5 ml/min, 20-250 mM imidazole gradient70-80%
SUMO Protease Cleavage50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 8.01:100 enzyme:protein ratio, 4°C overnight90-95% efficiency
Size Exclusion50 mM Tris, 150 mM NaCl, 0.1% n-dodecyl β-D-maltoside, 5% glycerol, pH 8.0Flow rate: 0.3 ml/min, sample load <5% column volume60-70%
Ion Exchange50 mM Tris, 0-500 mM NaCl gradient, 5% glycerol, pH 7.0Flow rate: 1 ml/min, shallow gradient85-90%

The final purified OLE1 should be stored in Tris/PBS-based buffer with 50% glycerol at -20°C/-80°C to maintain stability for up to 6 months . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What are the optimal conditions for studying OLE1-mediated oil body formation in vitro?

Reconstituting functional oil bodies with recombinant OLE1 in vitro provides a controlled system for mechanistic studies. The following protocol has been optimized based on research with similar proteins:

  • Lipid mixture preparation: Combine triacylglycerols (TAGs) isolated from Prunus dulcis with phospholipids (primarily phosphatidylcholine) in a 95:5 ratio (w/w). For enhanced stability, include phosphatidic acid (1% w/w).

  • Emulsion formation:

    • Dissolve lipids in chloroform, evaporate under nitrogen

    • Rehydrate with buffer (10 mM Tris, 150 mM NaCl, pH 7.5)

    • Sonicate to form a primary emulsion

    • Add purified recombinant OLE1 (protein:lipid ratio of 1:20 w/w)

    • Homogenize using a microfluidizer (17,000 psi, 3 passes)

  • Oil body characterization:

ParameterMethodExpected Results
Size distributionDynamic light scatteringMean diameter: 0.5-2 μm
StabilityTurbidity measurements over time<10% change in turbidity over 7 days at 4°C
MorphologyTransmission electron microscopySpherical bodies with uniform OLE1 coating
Protein orientationProtease protection assayN/C termini accessible, hydrophobic domain protected
TAG contentNile red fluorescenceLinear correlation with TAG concentration
  • Experimental variables for optimization:

    • pH range: Test stability from pH 5.5-8.0

    • Ionic strength: 50-300 mM NaCl

    • Temperature: 4-37°C

    • OLE1 concentration: 0.1-1.0 mg/ml

    • TAG composition: Varying fatty acid profiles

Critical controls include artificial oil bodies without OLE1 (unstable control) and bodies formed with heat-denatured OLE1 (non-functional protein control). The reconstituted bodies should be analyzed immediately or stored at 4°C with minimal agitation for short-term studies.

What quantitative methods can accurately measure OLE1 gene expression in developing seeds?

Accurate quantification of OLE1 expression requires sensitive and specific methods, especially when analyzing developmental series or comparing expression across tissues. Based on successful approaches with oleosin genes, the following methodologies are recommended:

  • RNA extraction optimization: Developing seeds contain high levels of interfering compounds (lipids, polysaccharides, secondary metabolites). A modified CTAB-based extraction method with additional purification steps yields high-quality RNA suitable for downstream applications .

  • RT-qPCR analysis: Both TaqMan and SYBR Green qPCR methods have been successfully employed for oleosin gene expression analysis :

qPCR MethodAdvantagesLimitationsPrimer Design Considerations
TaqManHigher specificity, multiplexing capabilityHigher cost, complex designProbe sequence: AGCAGCTGGATCAGG (based on similar oleosin)
SYBR GreenCost-effective, simpler setupPotential for non-specific amplificationPrimers must span exon junctions to prevent genomic DNA amplification

For OLE1 quantification, validated primer sets have been developed for related oleosins:

  • Forward primer: 5'-AAGGCACGGGAAATGAAAGA-3'

  • TaqMan probe: 5'-AGGGCTGAGCAGTTAG-3'

  • Reverse primer: 5'-TGTTGGCCCGTTACATGCT-3'

  • Reference gene selection: For accurate normalization, multiple reference genes should be evaluated for stability across developmental stages. Common candidates include Actin, GAPDH, and EF1α, with validation using algorithms like geNorm or NormFinder.

  • Absolute quantification: For comparing expression levels between different oleosin genes, absolute quantification using standard curves generated from plasmids containing the target sequences provides more accurate results than relative quantification.

  • Spatial expression analysis: In situ hybridization using OLE1-specific probes can visualize the spatial pattern of expression within seed tissues, complementing quantitative measurements.

When analyzing developmental series, collecting samples at consistent times of day minimizes circadian effects on expression. Technical replicates (minimum 3) and biological replicates (minimum 3) are essential for statistical robustness in expression studies .

How can researchers differentiate between the roles of different oleosin isoforms in Prunus dulcis?

Distinguishing the specific functions of OLE1 from other oleosin isoforms in Prunus dulcis requires a multi-faceted approach combining molecular, biochemical, and imaging techniques:

  • Isoform-specific gene silencing: RNA interference (RNAi) or CRISPR-Cas9 techniques targeting the unique regions of OLE1 can create knockdown or knockout lines. Phenotypic analysis reveals isoform-specific functions through:

    • Altered oil body morphology

    • Changes in seed oil content

    • Modified seed viability and germination rates

    • Alterations in oil mobilization during germination

  • Complementation studies: Expressing different oleosin isoforms in knockout backgrounds determines functional redundancy versus specialization. Cross-species complementation using Arabidopsis oleosin mutants can provide additional insights.

  • Protein-protein interaction studies:

MethodApplicationOutcome Measures
Yeast two-hybridIdentifying OLE1-specific protein partnersNovel interacting proteins unique to OLE1
Co-immunoprecipitationVerifying interactions in native contextConfirmation of in vivo interactions
Bimolecular fluorescence complementationVisualizing interaction locationsSubcellular localization of interactions
  • Comparative expression analysis: The relative expression levels of different oleosin isoforms during seed development provide clues to their specialized functions . OLE1, OLE2, and OLE3 genes are expressed at much higher levels than OLE4 and OLE5 in developing seeds, suggesting predominant roles in oil accumulation .

  • Structural differences analysis: Detailed comparison of structural features across isoforms, particularly differences outside the conserved proline knot region, can identify potential functional specialization domains.

Studies in related species have demonstrated that the expression patterns of different oleosin isoforms are well-coordinated with oil accumulation patterns, suggesting complementary rather than redundant functions . This coordinated expression likely reflects evolutionary specialization of oleosin isoforms for specific aspects of oil body formation, stabilization, or mobilization.

What biochemical assays can accurately determine the enzymatic activities attributed to OLE1?

Recent research suggests oleosins may function as bifunctional enzymes with both monoacylglycerol acyltransferase and phospholipase activities . Confirming and characterizing these activities in Prunus dulcis OLE1 requires rigorous biochemical approaches:

  • Monoacylglycerol acyltransferase (MGAT) activity assay:

    • Substrate: Radio-labeled monoacylglycerol (MAG) and acyl-CoA

    • Reaction conditions: 50 mM HEPES (pH 7.4), 100 mM NaCl, 5 mM MgCl₂

    • Detection: TLC separation of reaction products and scintillation counting

    • Controls: Heat-inactivated OLE1, known MGAT enzyme (positive control)

    • Analysis: Kinetic parameters (Km, Vmax) for different substrate combinations

  • Phospholipase activity characterization:

    • Substrate specificity determination using fluorescent phospholipid analogs

    • pH-activity profile (pH 5.0-9.0)

    • Calcium dependence analysis

    • Inhibitor sensitivity profiling

    • Product analysis by mass spectrometry

  • Regulatory mechanism investigation:

    • Effect of phosphorylation on enzymatic activities using:

      • Recombinant protein kinases

      • Phosphomimetic mutations (S/T to D/E)

      • Phosphorylation-resistant mutations (S/T to A)

    • Correlation between phosphorylation state and enzymatic activity

  • Structure-function relationships:

    • Identification of catalytic residues through site-directed mutagenesis

    • Domain mapping using truncation constructs

    • Effects of the proline knot motif on catalytic activities

ActivitySubstrateAssay MethodExpected Activity Range
MGAT2-oleoyl-glycerol + oleoyl-CoARadiolabeled substrate incorporation5-50 nmol/min/mg protein
Phospholipase A₂BODIPY-labeled phosphatidylcholineFluorescence increase1-10 nmol/min/mg protein
Phospholipase CFluorescent PIP₂Fluorescence polarization0.5-5 nmol/min/mg protein
Phospholipase DBODIPY-PCTransphosphatidylation assay0.1-2 nmol/min/mg protein

These enzymatic activities may be influenced by the protein's membrane association state, requiring parallel assays using free protein versus oil body-associated OLE1 to determine potential membrane activation effects .

How can Prunus dulcis OLE1 be utilized for improving oil content and quality in transgenic plants?

The potential biotechnological applications of Prunus dulcis OLE1 extend beyond basic research to practical crop improvement strategies:

  • Increasing oil yield: Overexpression of OLE1 in oilseed crops can potentially increase oil content through:

    • Enhanced oil body formation and stability

    • Reduced oil body size, increasing surface-to-volume ratio and potentially allowing more efficient packing

    • Possible enhancement of TAG biosynthesis through feedback mechanisms

  • Oil stability enhancement: OLE1 expression can improve oil stability in seeds by:

    • Protecting TAGs from lipase access during seed storage

    • Reducing oxidative damage through limited oxygen exposure

    • Maintaining oil body integrity during seed desiccation and rehydration

  • Designer oil bodies for specialized applications:

    • Fusion proteins combining OLE1 with enzymes/proteins of interest

    • Creation of self-assembling protein-lipid nanoparticles

    • Development of edible oil bodies with modified surface properties

  • Transgenic approach considerations:

StrategyTarget GenesExpected OutcomePotential Challenges
OLE1 overexpressionNative promoter with OLE110-20% increase in oil contentPossible developmental abnormalities
Combined expressionOLE1 + DGAT1 + FAD2Altered fatty acid profile with increased oilMetabolic burden on developing seeds
Seed-specific expressionSeed-specific promoter driving OLE1Tissue-targeted oil enhancementMaintaining proper expression timing
N-terminal OLE1 fusionsOLE1 + functional proteinsNovel oil body surface functionalitiesProper folding of fusion proteins
  • Transformation and selection methods:

    • Agrobacterium-mediated transformation for stable integration

    • Biolistic delivery for recalcitrant species

    • CRISPR-based promoter editing for enhanced native expression

The coordination between OLE1 expression and other oil biosynthetic genes is critical for successful engineering . Studies show that expression of multiple oleosin genes (OLE1, OLE2, OLE3) increases during seed development in coordination with oil accumulation, suggesting that a multi-gene approach may be more effective than single gene manipulation .

What quality control methods ensure functional integrity of recombinant OLE1 for research applications?

Ensuring the functional integrity of recombinant OLE1 is critical for research reliability. A comprehensive quality control workflow includes:

  • Protein identity confirmation:

    • Mass spectrometry analysis (MALDI-TOF or ESI-MS) to confirm molecular weight

    • N-terminal sequencing to verify correct processing

    • Peptide mapping following protease digestion

    • Western blot using anti-OLE1 antibodies

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Tryptophan fluorescence to evaluate tertiary structure

    • Differential scanning calorimetry to determine thermal stability

    • Dynamic light scattering to detect aggregation

  • Functional validation:

    • Oil body reconstitution assay (successful formation of stable artificial oil bodies)

    • Lipid binding assay using fluorescent lipid probes

    • Enzymatic activity assays (if investigating MGAT or phospholipase activities)

    • Electron microscopy of formed oil bodies

  • Stability monitoring:

Storage ConditionRecommended Testing IntervalExpected Stability Period
-80°C, lyophilized6 monthsUp to 12 months
-20°C, 50% glycerol3 monthsUp to 6 months
4°C, working solution2 daysUp to 1 week
  • Batch-to-batch consistency checks:

    • SDS-PAGE with densitometry (>90% purity)

    • Activity assay standardization

    • Reference standard comparison

    • Certificate of analysis for each batch

  • Application-specific validation:

    • Microscopy of labeled OLE1 association with membranes

    • Protease protection assays to confirm proper membrane topology

    • Co-immunoprecipitation to verify expected protein-protein interactions

For long-term storage, recombinant OLE1 should be maintained in Tris/PBS-based buffer with 50% glycerol at -20°C/-80°C, with aliquoting to avoid repeated freeze-thaw cycles . Working aliquots should be stored at 4°C and used within one week .

What are the current research gaps in understanding Prunus dulcis OLE1 function and applications?

Despite significant advances in oleosin research, several critical knowledge gaps remain regarding Prunus dulcis OLE1:

  • Structural characteristics: While the primary sequence and basic properties are known, high-resolution structural data (X-ray crystallography or cryo-EM) is lacking for any plant oleosin, including OLE1. This limits our understanding of how the protein's structure relates to its functions in oil body formation and stability.

  • Regulatory networks: The transcriptional and post-transcriptional regulation of OLE1 expression during seed development remains poorly characterized. Identification of transcription factors, enhancers, and potential microRNA regulation would provide insights into the coordinated expression of OLE1 with other lipid biosynthetic genes .

  • Enzymatic activities: While potential monoacylglycerol acyltransferase and phospholipase activities have been suggested for oleosins , conclusive evidence for these activities in Prunus dulcis OLE1 is lacking. Determining whether these are primary functions or secondary activities would reshape our understanding of oleosin's role.

  • Protein-protein interactions: The interactome of OLE1 remains largely unexplored. Identifying interaction partners could reveal connections to broader metabolic networks and regulatory pathways beyond oil body formation.

  • Evolutionary specialization: While phylogenetic analysis places OLE1 within one of five oleosin subfamilies , the functional consequences of this evolutionary diversification are not fully understood. Comparative functional studies across species could reveal specialized adaptations.

Addressing these research gaps requires interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and systems biology. The development of improved heterologous expression systems for OLE1 provides new opportunities to produce sufficient quantities of protein for advanced structural and functional studies, potentially leading to novel biotechnological applications in agriculture and industry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.