Recombinant Prunus persica Ethylene receptor (ETR1)

Shipped with Ice Packs
In Stock

Description

Introduction

Ethylene is a gaseous hormone that plays a crucial role in plant growth, development, and stress responses . In Prunus persica (peach), ethylene is involved in fruit ripening, among other processes . Ethylene receptors, such as ETR1, are essential for the plant's perception of ethylene and the subsequent activation of downstream signaling pathways . Recombinant Prunus persica Ethylene Receptor (ETR1) refers to the ETR1 protein from peach that has been produced using recombinant DNA technology.

Structure and Function of ETR1

The ETR1 protein is a member of a small family of ethylene receptors in plants . The Arabidopsis thaliana ETR1 gene encodes a protein with a hydrophobic N-terminal domain that binds ethylene and a C-terminal domain related in sequence to histidine kinase-response regulator two-component signal transducers found in bacteria .

A structural model suggests a Cu(I) ion is coordinated within membrane-spanning alpha-helices of the hydrophobic domain . Ethylene binding to this transition metal may induce a conformational change in the sensor domain, which is then propagated to the cytoplasmic transmitter domain of the protein .

Cloning and Characterization of PpETR1

To identify ethylene perception-related processes in peach, researchers have cloned and characterized a peach homolog of the gene encoding the ethylene receptor, ETR1 . A fragment of the peach gene, PpETR1, was obtained via PCR and used to screen a cDNA library made from ripening fruit . The resulting cDNA clones indicate that the PpETR1 coding region is highly similar to other ETR1 homologs .

Alternative Splicing of PpETR1 mRNA

The messenger RNA of PpETR1 undergoes unusual alternative splicing, potentially resulting in three different mature transcripts .

  • PpETR1a: Use of an alternative 3' splice site removes three amino acids within the receiver-like domain .

  • PpETR1b: Retention of the terminal intron results in a truncated protein lacking a receiver-like domain .

  • The existence of three different, but related versions of the receptor protein that could be synthesized from this single gene has been discovered .

Expression Analysis

Variations in PpETR1 transcript abundance in wounding experiments indicate that the properly spliced and unspliced versions have different accumulation patterns in fruit, whereas both are essentially constitutive in leaves . These observations indicate that changes in ethylene sensitivity may occur during wounding in fruit .

Role in Ethylene Signal Transduction

ETR1 may play a crucial role in the early stages of ethylene signal transduction, potentially functioning as an ethylene receptor or a regulator of the pathway . Genetic and biochemical studies have shown that receptors act redundantly to suppress ethylene responses in the absence of ethylene . An increase in receptor transcripts in ripening fruits is seen as a response to increased ethylene biosynthesis, which is an attempt to maintain homeostasis and temper the ethylene response .

Recombinant Production and Applications

Recombinant ETR1 protein is produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells. Recombinant ETR1 is valuable for in vitro studies of ethylene binding, protein interactions, and structural analysis . These studies contribute to a better understanding of ethylene perception and signaling in plants, which has implications for crop improvement and fruit ripening control .

Copper Stoichiometry

Researchers have determined protein-related copper stoichiometries on purified receptor preparations and explored the helix arrangement by tryptophan scanning mutagenesis to refine and validate structural models of the transmembrane sensor domain of ETR1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ETR1; Ethylene receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Prunus persica (Peach) (Amygdalus persica)
Target Names
ETR1
Target Protein Sequence
MEACNCIEPQWPADELLMKYQYISDFFIALAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFSMHSRTVAIVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRQQNPVGYTVPIHLPVINQVFSSNRALKISPNSPVARMRPLAG KHMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNIALDLARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTPEQRLMVETILKSSHLLATLINDVLDLSRLEDGSLQLEIATFNLH SVFREVHNLIKPVASVKKLSVSLNLAADLPVQAVGDEKRLMQIVLNVVGNAVKFSKEGSI SITAFVAKSESLRDFRAPEFFPAQSDNHFYLRVQVKDSGSGINPQDIPKLFTKFAQTQSL ATRNSGGSGLGLAICKRFVNLMEGHIWIESEGPGKGCTAIFIVKLGFAERSNESKLPFLT KVQANHVQTNFPGLKVLVMDDNGSVTKGLLVHLGCDVTTVSSIDEFLHVISQEHKVVFMD VCMPGIDGYELAVRIHEKFTKRHERPVLVALTGNIDKMTKENCMRVGMDGVILKPVSVDK MRSVLSELLEHRVLFEAM
Uniprot No.

Target Background

Function
This protein may play an early role in the ethylene signal transduction pathway, potentially functioning as an ethylene receptor or a pathway regulator.
Database Links

UniGene: Ppe.19094

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does Pp-ETR1 expression change during fruit ripening?

Unlike some ethylene receptors, Pp-ETR1 transcript levels remain relatively stable throughout the peach fruit ripening process. Quantitative RT-PCR analysis has shown that Pp-ETR1 mRNA levels do not significantly change during the climacteric rise in ethylene production . This contrasts with the related receptor Pp-ERS1, which shows increased expression that parallels the ethylene climacteric phase . This differential expression pattern suggests distinct roles for these receptors in the ethylene signaling network during fruit ripening.

What are the conserved functional domains in Pp-ETR1?

The deduced Pp-ETR1 protein contains a sensor domain responsible for ethylene binding and a histidine kinase domain that participates in signal transduction. Key residues thought to be critical for normal function in ETR1-type proteins are conserved in the peach homolog, suggesting that Pp-ETR1 functions as a bona fide ethylene receptor with ethylene-binding capacity . The receiver domain, which is present in subfamily I ethylene receptors but absent in subfamily II receptors, is also present in Pp-ETR1, placing it firmly in the ETR1 subfamily .

How do Pp-ETR1 and Pp-ERS1 differ in their response to stress conditions?

While both receptors function in ethylene perception, they show different responses to environmental stresses. Pp-ERS1 transcription is rapidly induced by dehydration (peaking at 1 hour post-treatment), wounding (with 12-fold increases at 6 hours), pathogen infection, and ethephon treatment . In contrast, Pp-ETR1 typically shows more stable expression patterns under these conditions. This difference suggests that Pp-ERS1 may play a more dynamic role in stress responses compared to Pp-ETR1 .

What are effective protocols for cloning and expressing recombinant Pp-ETR1?

For recombinant expression of Pp-ETR1, E. coli-based systems have been successfully employed for peach proteins, as demonstrated with other peach proteins like Pru p 1 . A recommended protocol includes:

  • PCR amplification of the Pp-ETR1 coding sequence using high-fidelity polymerase

  • Cloning into an expression vector with an N-terminal histidine tag

  • Expression in E. coli under IPTG induction

  • Purification via nickel affinity chromatography

  • Verification by SDS-PAGE and Western blotting

Researchers should consider that membrane proteins like ETR1 may require specialized approaches, including the use of detergents during purification or insect cell expression systems for proper folding .

How can researchers accurately measure Pp-ETR1 expression in different tissues?

For accurate quantification of Pp-ETR1 expression:

  • Real-time quantitative PCR (RT-qPCR) is the method of choice, allowing precise measurement of transcript abundance.

  • Reference genes should be carefully selected based on their stability in peach tissues—actin and ubiquitin genes have shown consistent expression across various peach tissues and developmental stages.

  • For protein-level analysis, Western blotting with specific antibodies against Pp-ETR1 is recommended.

  • For spatial expression patterns, in situ hybridization or promoter-reporter fusions (like the GUS reporter system used for Pp-ERS1) provide valuable information .

Researchers should ensure appropriate normalization controls and consider the potential for alternative splicing when designing primers and interpreting results .

How do polyamines affect Pp-ETR1 expression and function during fruit ripening?

Polyamines like putrescine (Pu) and spermidine (Sd) significantly impact ethylene perception in peach fruit. When applied exogenously, these polyamines increase the transcript abundance of Pp-ETR1 at harvest time while inhibiting fruit softening and abscission . This suggests a complex regulatory relationship between polyamines and ethylene signaling.

The mechanism appears to involve:

  • Increased transcription of ethylene receptor genes (including Pp-ETR1)

  • Simultaneous suppression of ethylene biosynthesis genes like Pp-ACO1

  • Altered receptor sensitivity to ethylene

These effects are comparable to those observed with aminoethoxyvinylglycine (AVG) treatment, indicating potential shared regulatory pathways . Researchers investigating these interactions should consider both transcriptional and post-translational regulatory mechanisms.

What approaches can be used to study alternative splicing of ethylene receptor genes in peach?

Studying alternative splicing in Pp-ETR1 and related receptors requires specialized approaches:

  • 5' and 3' RACE (Rapid Amplification of cDNA Ends) to identify all transcript variants

  • Next-generation sequencing of the transcriptome (RNA-Seq) to quantify splice variant abundance

  • RT-PCR with primers spanning potential splice junctions

  • Minigene constructs for functional analysis of splicing regulation

This is particularly important as alternative splicing has been observed in the related Pp-ERS1 gene, which produces at least three different transcripts (PpERS1A, B, and C) that differ in the length of the first intron in the 5' UTR . Researchers should sequence multiple clones (>100 recommended) to capture the full range of splice variants.

How does the promoter structure of ethylene receptor genes regulate their expression in response to stress?

The promoter regions of peach ethylene receptor genes contain multiple regulatory elements that control their expression under various conditions. For Pp-ERS1, these include:

  • Ethylene-responsive elements (EREs)

  • W-box motifs (TTGAC) recognized by WRKY transcription factors

  • MYB transcription factor binding sites

These elements mediate the receptor gene's response to abiotic stresses (dehydration, salt, temperature) and biotic factors (pathogens like L. theobromae) . For comprehensive promoter analysis, researchers should:

  • Perform 5' deletion analysis to identify enhancer elements

  • Use reporter gene constructs (like GUS) to analyze spatial and temporal expression patterns

  • Conduct chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter

  • Perform electrophoretic mobility shift assays (EMSA) to verify protein-DNA interactions

The presence of enhancer elements in the Pp-ERS1 promoter suggests complex regulation that likely extends to Pp-ETR1 as well .

How do Prunus persica ethylene receptors compare with receptors from other Rosaceae species?

Ethylene receptors in Rosaceae show high sequence conservation, with Pp-ETR1 exhibiting greatest homology to receptors from other stone fruits. Sequence analysis reveals:

SpeciesProteinSequence Homology to Pp-ERS1
Prunus salicinaERS198%
Pyrus communisERS185%
Pyrus pyrifoliaERS186%
Malus domesticaERS187%
Fragaria × ananassaERS183%

This high level of conservation suggests similar functional mechanisms across Rosaceae, with subtle differences potentially reflecting species-specific adaptation in ethylene sensitivity and response . For Pp-ETR1, similar patterns of conservation are observed, with the highest homology to other Prunus species.

What factors influence the differential expression of Pp-ETR1 versus Pp-ERS1 during fruit development?

Multiple factors contribute to the differential expression patterns of Pp-ETR1 and Pp-ERS1:

  • Distinct promoter architectures - Pp-ERS1 contains a 28 nucleotide motif with high homology to binding sites for ethylene-responsive factors, which may explain its ethylene-inducible nature .

  • Developmental programming - While Pp-ETR1 maintains relatively stable expression throughout fruit development, Pp-ERS1 shows increased expression during ripening, suggesting differential roles in the ripening process .

  • Stress response elements - The Pp-ERS1 promoter contains multiple W-box elements that are recognized by WRKY transcription factors involved in stress responses, potentially explaining its more dynamic response to environmental stresses .

  • Hormone cross-talk - Polyamines and other hormonal regulators affect the two receptors differently, with Pp-ERS1 showing greater responsiveness to these regulatory inputs .

This differential regulation suggests specialized roles for each receptor in the complex network of ethylene perception during development and stress responses.

What approaches can be used to study the functional significance of alternative splicing in ethylene receptor genes?

To investigate the functional consequences of alternative splicing in Pp-ETR1 and related genes:

  • Express different splice variants in heterologous systems like yeast or Arabidopsis ethylene receptor mutants to assess their functionality

  • Use CRISPR/Cas9 genome editing to modify splice sites in peach and examine the phenotypic effects

  • Develop splice variant-specific antibodies to study protein localization and abundance

  • Analyze the three-dimensional structure of different receptor isoforms to understand how alternative splicing affects protein function

  • Investigate tissue-specific and stress-induced splicing patterns using RNA-Seq

These approaches could reveal how alternative splicing contributes to the fine-tuning of ethylene responses in different tissues and environmental conditions .

How can researchers effectively study the membrane-associated ETR1 complex in peach tissues?

Investigating membrane-associated ETR1 complexes presents unique challenges that can be addressed through:

  • Blue native PAGE to preserve protein-protein interactions during electrophoresis

  • Co-immunoprecipitation with specific antibodies against Pp-ETR1

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in planta

  • Proximity-dependent biotin identification (BioID) to identify proteins in close proximity to ETR1

  • Cryo-electron microscopy to elucidate the structure of membrane-associated receptor complexes

When conducting these studies, researchers should consider the lipid environment, as receptor function may depend on specific membrane compositions. Additionally, the subcellular localization of different Pp-ETR1 isoforms may vary, potentially affecting their signaling properties and protein interaction networks .

What strategies can address low expression levels of recombinant Pp-ETR1?

Researchers facing low expression of recombinant Pp-ETR1 should consider:

  • Optimizing codon usage for the expression host

  • Testing different expression systems (E. coli, yeast, insect cells)

  • Using fusion tags that enhance solubility (MBP, SUMO, TRX)

  • Expressing truncated versions containing specific domains

  • Adjusting induction parameters (temperature, IPTG concentration, induction time)

  • Using specialized E. coli strains that supply rare tRNAs or facilitate membrane protein expression

For membrane proteins like ETR1, expression in host systems that provide an appropriate membrane environment is particularly important for obtaining functional protein .

How can researchers address contradictory results in ethylene receptor expression studies?

When confronted with contradictory results regarding Pp-ETR1 expression:

  • Compare experimental methodologies carefully, as different RNA extraction methods can yield varying results with plant tissues

  • Consider tissue-specific expression patterns, as receptors may be regulated differently in different tissues

  • Account for developmental stage effects, as the timing of sampling can significantly impact expression profiles

  • Evaluate primers and probes for specificity, especially given the sequence similarity between different ethylene receptors

  • Validate results using multiple techniques (RT-qPCR, Northern blotting, RNA-Seq)

  • Consider the potential influence of alternative splicing, which may affect detection depending on primer placement

Contradictions may reflect genuine biological complexity rather than experimental error, highlighting the nuanced regulation of ethylene perception in different contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.