Recombinant Pseudalopex vetulus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Lycalopex vetulus (Hoary fox) (Pseudalopex vetulus)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSAVMV
Uniprot No.

Target Background

Function

Recombinant Pseudalopex vetulus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the CuA center (subunit 2) and heme A (subunit 1) to the active site (subunit 1). This binuclear center (BNC), composed of heme A3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (MT-CO2) and what is its role in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2, also known as COII, COX2, or COXII) is one of the core subunits of cytochrome c oxidase (Complex IV) in the mitochondrial respiratory chain. This protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, which is crucial for ATP production during cellular respiration . MT-CO2 contains a binuclear copper A center (CuA) that serves as the primary electron acceptor from cytochrome c . The protein plays an essential role in the electron transport chain, contributing to the electrochemical gradient that drives ATP synthesis by accepting electrons from cytochrome c and transferring them through the complex to ultimately reduce oxygen to water.

How is MT-CO2 encoded and where is it located in the genome?

MT-CO2 is encoded by the mitochondrial genome rather than the nuclear genome. In mammals, the MT-CO2 gene is located on the p arm of mitochondrial DNA at position 12 and spans approximately 683 base pairs . The gene encodes a protein of about 227 amino acids with a molecular weight of approximately 25.6 kDa . As part of the mitochondrial DNA, MT-CO2 is inherited maternally, which has significant implications for evolutionary studies. Despite its critical role in cellular respiration, studies have observed considerable sequence variation between populations of the same species, such as in Tigriopus californicus, where interpopulation divergence at the COII locus approached 20% at the nucleotide level . This variation makes MT-CO2 useful for phylogenetic studies, while core functional domains remain highly conserved due to their essential role.

Why would researchers use Recombinant Pseudalopex vetulus MT-CO2 for their studies?

Researchers might choose to use Recombinant Pseudalopex vetulus (Hoary fox) MT-CO2 for several scientific reasons:

  • Evolutionary studies: Analyzing MT-CO2 from wildlife species provides insights into mitochondrial adaptation to different environmental conditions and evolutionary relationships among canids

  • Comparative biochemistry: Comparing MT-CO2 from different species reveals conserved functional domains versus variable regions

  • Controlled experimental system: The recombinant form provides a purified system for studying protein structure, function, and interactions

  • Mutation studies: Enables site-directed mutagenesis to investigate structure-function relationships

  • Conservation biology: MT-CO2 can serve as a molecular marker to assess genetic diversity and population structure of this South American canid species

Additionally, using recombinant proteins eliminates the need for sampling from endangered or protected species while still allowing detailed molecular studies.

How can researchers effectively express and purify recombinant MT-CO2?

Effective expression and purification of functional recombinant MT-CO2 requires a carefully optimized protocol due to its membrane-associated nature and complex folding requirements:

Expression System Selection:

  • E. coli expression systems (BL21(DE3)) have been successfully used for COXII proteins

  • The gene should be codon-optimized for the expression host

  • Expression vectors containing 6-His tags facilitate purification

Expression Conditions:

  • Induction with IPTG (0.1-0.5 mM)

  • Lower expression temperatures (16-20°C) promote proper folding

  • Expression times of 16-24 hours allow proper accumulation

Purification Strategy:

StepMethodConditionsPurpose
1Cell lysisNative conditions with non-ionic detergentsSolubilize membrane proteins
2IMACNi²⁺-NTA agarose chromatographyCapture His-tagged protein
3Size exclusionGel filtration chromatographyPolishing step for high purity

Storage Conditions:

  • Store at -20°C/-80°C for extended storage

  • Include 50% glycerol in storage buffer

  • Aliquot to avoid repeated freeze-thaw cycles

This protocol can yield approximately 50 μg/mL of purified recombinant MT-CO2 with >90% purity as determined by SDS-PAGE . Western blotting confirms protein identity, with recombinant His-tagged MT-CO2 typically appearing at approximately 44 kDa due to the presence of the tag .

What techniques can be used to study the electron transfer function of recombinant MT-CO2?

Studying the electron transfer function of recombinant MT-CO2 requires sophisticated techniques that can capture the dynamics of electron movement:

Spectroscopic Methods:

  • UV-visible spectrophotometry can monitor cytochrome c oxidation at 550 nm

  • Electron paramagnetic resonance (EPR) spectroscopy directly observes the Cu₂ center's electronic states

  • Resonance Raman spectroscopy examines vibrational modes of metal centers

Enzymatic Activity Assays:

  • Cytochrome c oxidation assays: Measure the rate at which MT-CO2 catalyzes the oxidation of reduced cytochrome c

  • Oxygen consumption measurements: Quantify the rate of oxygen reduction using electrode systems

  • Inhibitor sensitivity tests: Assess response to known inhibitors like cyanide or allyl isothiocyanate (AITC)

Structural Analysis:

  • Molecular docking studies can predict interactions between MT-CO2 and substrates or inhibitors. For example, studies with Sitophilus zeamais COXII found that a sulfur atom of AITC could form a 2.9 Å hydrogen bond with Leu-31 .

When combined, these techniques provide comprehensive insights into electron transfer mechanisms, rate-limiting steps, and the effects of mutations or environmental conditions on MT-CO2 activity.

How can mutations in recombinant MT-CO2 be designed to study structure-function relationships?

Designing mutations in recombinant MT-CO2 requires a systematic approach based on structural information, evolutionary conservation, and functional domains:

Targeted Mutation Approaches:

  • Conserved Residue Mutations:

    • Identify amino acids conserved across species using multiple sequence alignments

    • Focus particularly on the CuA binding site (cysteine residues at positions 196 and 200)

    • Introduce conservative and non-conservative substitutions

  • Transmembrane Domain Alterations:

    • Modify residues in the N-terminal transmembrane helices

    • Investigate impacts on membrane anchoring and protein stability

  • Functional Assessment of Natural Variants:

    • Study natural variations that exist between populations

    • In Tigriopus californicus, nearly 20% nucleotide divergence in COII included 38 nonsynonymous substitutions

Experimental Validation:

  • Compare electron transfer kinetics between wild-type and mutant proteins

  • Assess copper binding capabilities

  • Evaluate protein stability using thermal shift assays

Studies in Tigriopus californicus have identified sites that may have experienced positive selection, providing natural examples of functional adaptation that can guide experimental design . Approximately 4% of codons in T. californicus COII evolve under relaxed selective constraint, while the majority are under strong purifying selection .

What approaches can be used to investigate MT-CO2's role in adaptive responses to environmental stressors?

Investigating MT-CO2's role in adaptive responses requires integrating molecular, cellular, and physiological approaches:

Expression Analysis Under Stress Conditions:

  • qRT-PCR to quantify MT-CO2 mRNA levels under different stressors

  • Western blotting to assess protein levels

  • In situ hybridization to examine tissue-specific expression changes

Functional Assessment:

  • Oxygen consumption measurements using high-resolution respirometry

  • CO2 detection experiments as performed in Anopheles gambiae

  • ATP production assays to determine impacts on energy metabolism

Environmental Adaptation Studies:

  • Carbon monoxide tolerance studies similar to those conducted with Cupriavidus necator H16

  • Temperature acclimation experiments as conducted with Skeletonema marinoi

Gene Regulation Analysis:

  • Analyze regulatory elements controlling MT-CO2 expression

  • In Anopheles gambiae, CO2 receptor subunits like AgGr22 showed significant enhancement in 4-day-old versus 1-day-old mosquitoes

By combining these approaches, researchers can establish how MT-CO2 contributes to organismal adaptation to environmental challenges, potentially identifying molecular mechanisms underlying thermal tolerance, hypoxia resistance, or adaptation to stressors like carbon monoxide.

How should researchers address issues with recombinant MT-CO2 stability during experiments?

Addressing stability issues with recombinant MT-CO2 requires systematic optimization of storage, handling, and experimental conditions:

Storage Optimization:

  • Store purified protein at -20°C/-80°C for extended storage

  • Add 50% glycerol to storage buffer to prevent freeze-thaw damage

  • Avoid repeated freeze-thaw cycles as this is not recommended

  • For working aliquots, store at 4°C for up to one week

Buffer Optimization:

ComponentRecommended RangePurpose
Buffer baseTris-based buffer, pH 7.5-8.0 Maintains optimal pH
Glycerol20-50% Prevents protein denaturation
Trehalose6% Stabilizes protein structure
Salt150-300 mM NaClMaintains ionic strength

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 5-50%

  • Aliquot for long-term storage at -20°C/-80°C

Stability Assessment:

  • Monitor protein stability over time using activity assays

  • Check for degradation using SDS-PAGE before experiments

  • Verify functional integrity through spectroscopic methods

By implementing these measures, researchers can significantly improve the stability of recombinant MT-CO2 during storage and experimentation, ensuring consistent and reliable results.

What control experiments are essential when working with recombinant MT-CO2?

When working with recombinant MT-CO2, a comprehensive set of control experiments is essential to ensure valid and reproducible results:

Protein Quality Controls:

  • Negative Control: Empty vector-expressed and purified sample

  • Positive Control: Well-characterized cytochrome oxidase subunit

  • Denatured Protein Control: Heat-inactivated MT-CO2

  • Tag-Only Control: Expression tag without MT-CO2 to identify tag-mediated artifacts

Functional Assay Controls:

  • Enzyme Concentration Series: Titration of MT-CO2 to establish linearity

  • Substrate Controls: Varying cytochrome c concentrations

  • Inhibitor Controls: Known inhibitors (cyanide, azide, allyl isothiocyanate)

  • Buffer-Only Control: Reaction mixture without MT-CO2

Specificity Controls:

  • Species Comparison: MT-CO2 from different species (e.g., comparing Pseudalopex vetulus to Sitophilus zeamais)

  • Cross-reactivity tests: When using antibodies or other detection methods

Studies with Sitophilus zeamais COXII demonstrated that UV-spectrophotometer and infrared spectrometer analysis could confirm that recombinant COXII catalyzes the oxidation of cytochrome c substrate , providing a potential positive control methodology.

How can researchers validate the functional integrity of recombinant MT-CO2?

Validating the functional integrity of recombinant MT-CO2 requires assessment of both structural characteristics and enzymatic activity:

Structural Integrity Assessment:

  • SDS-PAGE to confirm expected molecular weight (approximately 27.9 kDa for the core protein)

  • Western blotting with anti-MT-CO2 antibodies

  • Size exclusion chromatography to confirm proper oligomeric state

Metal Center Validation:

  • UV-Visible spectroscopy to confirm proper formation of the CuA center

  • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify copper content

Enzymatic Activity Assays:

  • Cytochrome c Oxidation Assay:

    • Prepare reduced cytochrome c substrate

    • Mix with recombinant MT-CO2

    • Monitor oxidation spectrophotometrically at 550 nm

    • Calculate enzyme activity rates

  • Inhibitor Sensitivity:

    • Test response to known inhibitors

    • For example, allyl isothiocyanate (AITC) has been shown to influence COXII activity

Comparative Analysis:

  • Compare activity with native cytochrome c oxidase

  • Benchmark against published values for related species

  • Assess activity across different experimental conditions

Research with Sitophilus zeamais COXII confirmed that recombinant protein could catalyze the oxidation of cytochrome c substrate , providing a methodology that can be adapted for Pseudalopex vetulus MT-CO2 validation.

What are common pitfalls when using recombinant MT-CO2 in enzymatic assays?

When using recombinant MT-CO2 in enzymatic assays, researchers should be aware of several common pitfalls:

Protein-Related Challenges:

  • Incomplete Metal Incorporation: Recombinant MT-CO2 may have incomplete copper incorporation

  • Non-Native Conformation: Expression in bacterial systems may result in altered folding

  • Tag Interference: The His-tag may affect activity or interactions

  • Aggregation: Membrane proteins are prone to aggregation during storage

Assay Design Issues:

  • Buffer Incompatibility: Inappropriate pH or ionic conditions can dramatically affect activity

  • Oxygen Limitation: In oxidase assays, dissolved oxygen can become limiting

  • Substrate Purity: Cytochrome c quality and reduction state must be carefully controlled

  • Temperature Sensitivity: Activity measurements are highly temperature-dependent

Interpretation Challenges:

  • Isolated Subunit vs. Complex: MT-CO2 alone differs from the complete cytochrome c oxidase complex

  • Species-Specific Differences: Results from one species may not directly translate to another

  • Batch Variation: Significant differences between protein preparations

Recommended Solutions:

PitfallSolution
Metal incorporationSupplement expression media with copper or reconstitute with copper after purification
Tag interferenceCompare tagged and tag-cleaved versions
AggregationInclude appropriate detergents and check protein state before assays
Oxygen limitationEnsure proper aeration or monitor oxygen levels during assays

By recognizing and addressing these common pitfalls, researchers can design more robust experiments and generate more reliable data when working with recombinant MT-CO2.

How can recombinant MT-CO2 be used to study canid evolution?

Recombinant MT-CO2 from Pseudalopex vetulus (Hoary fox) provides a valuable tool for studying canid evolution and adaptation:

Evolutionary Rate Analysis:

  • Compare MT-CO2 sequences across canid species

  • Calculate evolutionary rates and selection pressures

  • Identify lineage-specific adaptations

Functional Divergence Studies:

  • Express recombinant MT-CO2 from multiple canid species

  • Compare biochemical properties and activities

  • Correlate functional differences with habitat adaptations

Molecular Clock Applications:

  • Use MT-CO2 sequence divergence to estimate divergence times

  • Calibrate with fossil records of canid evolution

  • Study South American canid radiation patterns

Studies of other species have shown that mitochondrial genes like MT-CO2 can exhibit high levels of interpopulation divergence (up to 20% at the nucleotide level in some organisms) , making them valuable markers for evolutionary studies. The identification of positive selection in some MT-CO2 codons suggests adaptation to different environmental conditions , which could be particularly relevant for understanding canid diversification across varied habitats.

What insights can comparative analysis of MT-CO2 provide about metabolic adaptation?

Comparative analysis of MT-CO2 across species can reveal important insights about metabolic adaptation to different environments:

Environmental Adaptation Signatures:

  • Temperature adaptation: Compare MT-CO2 from species in different thermal environments

  • Hypoxia resistance: Analyze MT-CO2 from high-altitude versus lowland species

  • Metabolic rate correlation: Compare MT-CO2 properties with species-specific metabolic rates

Experimental Approaches:

  • Enzyme kinetics comparisons across temperature ranges

  • Oxygen affinity measurements under varying conditions

  • Resistance to inhibitors or stressors

Case Studies and Examples:

  • Studies with marine copepods showed that MT-CO2 exhibits significant interpopulation divergence correlating with thermal adaptation

  • Research on CO2 detection in mosquitoes demonstrated developmental regulation of related genes

  • Experiments with bacteria showed adaptation to carbon monoxide toxicity through respiratory chain modifications

A comprehensive analytical approach could involve recombinant expression of MT-CO2 from multiple canid species, followed by detailed biochemical characterization and correlation with environmental parameters of their native habitats. This would provide insights into how cellular respiration has adapted to support diverse ecological niches within the canid family.

How can MT-CO2 research contribute to conservation biology of canid species?

Research on Pseudalopex vetulus MT-CO2 can contribute significantly to conservation biology efforts for canid species:

Population Genetics Applications:

  • Develop MT-CO2-based markers for population structure analysis

  • Assess genetic diversity within and between populations

  • Identify evolutionarily significant units for conservation

Adaptive Potential Assessment:

  • Evaluate functional variation in MT-CO2 across populations

  • Correlate genetic variants with fitness parameters

  • Predict population resilience to environmental changes

Conservation Management Tools:

  • Create genetic monitoring protocols based on MT-CO2 markers

  • Develop non-invasive sampling techniques for MT-CO2 analysis

  • Inform captive breeding programs through genetic insights

Research on other species has demonstrated that genes like MT-CO2 can show signatures of positive selection within certain populations , which could help identify locally adapted populations requiring specific conservation attention. The hoary fox (Pseudalopex vetulus) is a Brazilian endemic canid with specialized ecological requirements, making it an important subject for conservation-focused research.

What interdisciplinary approaches can enhance MT-CO2 research?

MT-CO2 research benefits from interdisciplinary approaches that integrate multiple scientific perspectives:

Cross-Disciplinary Collaborations:

  • Biochemistry + Ecology: Link molecular function to habitat specialization

  • Evolutionary Biology + Structural Biology: Connect sequence evolution to protein structure

  • Conservation Biology + Molecular Biology: Apply MT-CO2 markers to population monitoring

Emerging Technologies:

  • Cryo-EM for structural analysis of intact respiratory complexes

  • Nanoscale respirometry for single-cell metabolic measurements

  • Environmental DNA analysis for non-invasive population monitoring

Integrated Data Analysis:

DisciplineContributionIntegration Point
GenomicsMT-CO2 sequence variationPopulation structure analysis
BiochemistryFunctional characterizationAdaptation mechanisms
EcologyHabitat parametersSelection pressures
PhysiologyMetabolic measurementsFitness consequences

Recent research exemplifies this interdisciplinary approach, such as studies combining molecular evolution analysis with biochemical characterization and fitness measurements in hybrid populations , or investigations connecting CO2 detection at the molecular level with behavioral responses in insects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.