AA Sequence: YPVFAQQGYKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQV QANGKKGDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNLYYQPYSSEQKNILVIGPIPG KLYNEMVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKIT EITPTGKKGGFDITIQTLNGETVIDKVPAGPELIVTKDQTIQVDQPLTNNPNVGGFGQAE AEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF
Tag Info: The tag type is determined during the production process .
Purity: Information regarding the purity level of the recombinant protein is not available.
Expression System: Information regarding the expression system used to produce the recombinant protein is not available.
Apocytochrome f is a critical component of the cytochrome $$b_6f$$ complex, a protein complex found in the thylakoid membranes of chloroplasts in green algae and plants . This complex mediates electron transfer between photosystem II and photosystem I during photosynthesis. Apocytochrome f specifically functions as an electron carrier, accepting electrons from plastoquinol () and donating them to plastocyanin .
Due to its role in photosynthesis, Apocytochrome f has been a subject of interest in studies related to:
Photosynthetic Efficiency: Understanding the structure and function of Apocytochrome f can help in improving photosynthetic efficiency in algae and plants .
Algal Evolution: The mitochondrial DNA sequence of Pseudendoclonium akinetum, which contains the petA gene, has been studied to understand the evolutionary relationships between different green algae .
Biotechnology: Chloroplast genetic engineering has been used to express various proteins, including those involved in photosynthesis, for biotechnological applications such as herbicide, insect, and disease resistance, drought and salt tolerance, and phytoremediation .
Apocytochrome f is the precursor form of cytochrome f, a critical component of the cytochrome b6f complex that mediates electron transfer between photosystems II and I in the photosynthetic electron transport chain. In Pseudendoclonium akinetum, a green alga, the petA gene encodes this protein which, after processing and heme attachment, becomes functional cytochrome f. The mature protein contains approximately 285 amino acids (with the expression region spanning residues 45-329) and is essential for photosynthetic function . The protein's primary role is to transfer electrons from plastoquinol to plastocyanin in the thylakoid lumen, making it a crucial component for photosynthetic energy generation.
Pseudendoclonium akinetum Apocytochrome f has several key structural features essential for its function. Based on the amino acid sequence (YPVFAQQGYKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQVQANGKKGDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNLYYQPYSSEQKNILVIGPIPGKLYNEMVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKITEITPTGKKGGFDITIQTLNGETVIDKVPAGPELIVTKDQTIQVDQPLTNNPNVGGFGQAEAEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF), it contains conserved cysteine residues involved in heme attachment and several domains critical for protein-protein interactions . Like other cytochrome f proteins, it likely has a large hydrophilic domain facing the thylakoid lumen, a single transmembrane anchor near the C-terminus, and a short stromal tail. Studies on related cytochrome f proteins suggest that the alpha-amino group of the N-terminal tyrosine (Tyr1) forms one of the axial ligands to the heme iron after signal sequence cleavage .
Processing of Apocytochrome f involves several key steps that transform the inactive precursor into the functional cytochrome f. This multistep process includes:
Synthesis: The petA gene is transcribed and translated to produce pre-apocytochrome f
Membrane Targeting: The signal sequence directs the protein to the thylakoid membrane
Signal Sequence Cleavage: Thylakoid processing peptidase removes the signal sequence
Heme Attachment: Covalent ligation of c-type heme to specific cysteine residues by a heme lyase
Folding and Assembly: The protein adopts its final conformation and integrates into the cytochrome b6f complex
Research on Chlamydomonas reinhardtii has shown that heme binding is not a prerequisite for cytochrome f processing, indicating these steps can occur independently . The pre-apocytochrome f adopts a suitable conformation for cysteinyl residues to interact with heme lyase, and the pre-holocytochrome f folds into an assembly-competent conformation even when processing is delayed .
Selecting an appropriate expression system is crucial for obtaining functional Recombinant Pseudendoclonium akinetum Apocytochrome f. Researchers should consider these methodological approaches:
Expression System Selection Table:
| Expression System | Advantages | Limitations | Recommended For |
|---|---|---|---|
| E. coli | High yield, cost-effective, rapid growth | May lack proper folding machinery for algal proteins | Structure studies requiring high quantities |
| Yeast (e.g., Pichia pastoris) | Post-translational modifications, higher eukaryote | Slower production than E. coli | Functional studies requiring proper folding |
| Algal systems (e.g., Chlamydomonas) | Native-like folding and processing | Lower yield, more complex cultivation | Studies focused on authentic protein interactions |
| Cell-free systems | Rapid production, avoids toxicity issues | Higher cost, lower yield | Preliminary studies, toxic protein variants |
For most applications, a modified E. coli system with co-expression of helper proteins for heme attachment (e.g., cytochrome c maturation proteins) is recommended, as this balances yield with proper protein processing. Expression should be optimized using low temperatures (16-18°C) and reduced inducer concentrations to promote proper folding of this complex protein.
Purification of Recombinant Pseudendoclonium akinetum Apocytochrome f requires a strategic approach to maintain structural integrity and functional activity:
Initial Extraction: Use gentle detergents (0.5-1% n-dodecyl-β-D-maltoside) for membrane-associated forms, or standard lysis buffers for soluble constructs
Affinity Chromatography: If tagged (often His-tag), use immobilized metal affinity chromatography (IMAC) with imidazole gradient elution
Ion Exchange Chromatography: Apply anion exchange (e.g., Q-Sepharose) at pH 8.0 to separate charged variants
Size Exclusion Chromatography: Final polishing step to separate monomeric protein from aggregates
Quality Control: Assess purity by SDS-PAGE and Western blot, confirm heme incorporation by spectroscopic analysis
Throughout purification, buffer conditions should include stabilizers (10-20% glycerol) and reducing agents (1-5 mM β-mercaptoethanol) to prevent oxidative damage and maintain protein stability. For structural studies, additional purification steps may be necessary to achieve >95% purity.
Verification of structural integrity is essential before proceeding with experiments. A comprehensive assessment should include:
Analytical Methods for Structural Verification:
UV-Visible Spectroscopy: Properly folded cytochrome f with attached heme shows characteristic absorption peaks at approximately 420 nm (Soret band) and 520-550 nm (α/β bands)
Circular Dichroism (CD): Confirms secondary structure content and proper folding
Mass Spectrometry: Verifies molecular weight and can identify post-translational modifications
Thermal Shift Assay: Evaluates protein stability and can help optimize buffer conditions
Functional Assays: Electron transfer activity using artificial electron donors/acceptors
Limited Proteolysis: Assesses tertiary structure by examining resistance to proteolytic degradation
These methods should be used in combination rather than relying on a single technique to confirm that the recombinant protein adopts a native-like conformation with proper heme incorporation.
Recombinant Pseudendoclonium akinetum Apocytochrome f serves as a valuable tool for multiple research applications:
Structural Biology: Crystallography and cryo-EM studies to determine high-resolution structures
Electron Transport Studies: Investigation of electron transfer mechanisms in photosynthetic systems
Protein-Protein Interaction Analysis: Identifying binding partners in the electron transport chain
Evolutionary Biology: Comparative studies between different algal species to trace photosynthetic evolution
Protein Folding Research: Understanding c-type cytochrome biogenesis and membrane protein insertion
Antibody Production: Generation of specific antibodies for detection of cytochrome f in native systems
Photosynthesis Research: Reconstitution experiments to study cytochrome b6f complex assembly and function
When designing experiments, researchers should consider the specific properties of Pseudendoclonium akinetum Apocytochrome f, including its redox potential, heme coordination, and membrane association characteristics.
To effectively study interactions between Recombinant Pseudendoclonium akinetum Apocytochrome f and other proteins, researchers should consider these methodological approaches:
Protein-Protein Interaction Methods Table:
| Method | Sensitivity | In vitro/In vivo | Advantages | Limitations |
|---|---|---|---|---|
| Co-immunoprecipitation | Moderate | Both | Detects native interactions | Requires high-quality antibodies |
| Pull-down assays | Moderate | In vitro | Simple, good for initial screening | May detect non-physiological interactions |
| Surface Plasmon Resonance | High | In vitro | Quantitative kinetics and affinity | Requires protein immobilization |
| Isothermal Titration Calorimetry | High | In vitro | Label-free, provides thermodynamic data | Requires significant protein amounts |
| Crosslinking Mass Spectrometry | High | Both | Identifies interaction interfaces | Complex data analysis |
| FRET/BRET | High | In vivo | Real-time monitoring in living cells | Requires protein labeling |
| Yeast Two-Hybrid | Moderate | In vivo | High-throughput screening | High false positive rate |
When studying membrane proteins like cytochrome f, special consideration should be given to maintaining the native membrane environment or using appropriate detergents/nanodiscs to preserve protein conformation and interaction surfaces.
Site-directed mutagenesis provides powerful insights into structure-function relationships of Pseudendoclonium akinetum Apocytochrome f. A methodical approach includes:
Target Selection: Identify conserved residues from sequence alignments with homologous proteins or from structural models
Mutagenesis Design:
Substitute heme-binding cysteines to confirm their role (similar to the study in Chlamydomonas where researchers replaced cysteinyl residues with valine and leucine)
Modify residues at the predicted plastocyanin binding site to investigate electron transfer
Alter processing site residues to study protein maturation
Expression and Analysis: Express mutants under identical conditions and perform comparative analyses of:
Heme incorporation (spectroscopic properties)
Protein stability (thermal denaturation)
Electron transfer rates (kinetic measurements)
Complex assembly (native gel electrophoresis)
Processing efficiency (western blotting)
This systematic approach allows researchers to build a comprehensive functional map of Pseudendoclonium akinetum Apocytochrome f domains and critical residues.
Post-translational modifications (PTMs) significantly impact the maturation and function of Pseudendoclonium akinetum Apocytochrome f. The most critical modification is heme attachment, but other potential PTMs may include:
Signal Sequence Cleavage: Essential for proper protein localization and function, generating the N-terminal tyrosine that serves as a heme ligand
Heme Attachment: Covalent binding to conserved cysteine residues creates the functional c-type cytochrome
Potential Phosphorylation: May regulate protein-protein interactions or electron transfer efficiency
Membrane Insertion: Proper integration into the thylakoid membrane is crucial for function
Research on Chlamydomonas has demonstrated that cytochrome f can assemble into the cytochrome b6f complex even when processing of the precursor is delayed, but proper processing is ultimately required for optimal function . When investigating PTMs, researchers should employ a combination of mass spectrometry, site-directed mutagenesis, and functional assays to correlate specific modifications with functional outcomes.
Comparative genomic analysis of the petA gene across algal species reveals important evolutionary patterns:
Evolutionary Conservation Analysis:
The petA gene encoding Apocytochrome f shows significant conservation across photosynthetic organisms, particularly in functional domains involved in electron transfer and protein-protein interactions. Key findings from comparative analyses include:
Domain Conservation: The heme-binding motif (CxxCH) is universally conserved across all photosynthetic organisms
Species-Specific Adaptations: Variable regions may reflect adaptations to different ecological niches
Evolutionary Rate: petA evolves more slowly than nuclear-encoded photosynthetic genes due to functional constraints
Horizontal Gene Transfer: Some algal lineages show evidence of horizontal gene transfer events affecting petA
Methodology for comparative analysis should include:
Multiple sequence alignment of petA sequences from diverse photosynthetic organisms
Phylogenetic tree construction to visualize evolutionary relationships
Calculation of selection pressures (dN/dS ratios) across different domains
Correlation of sequence variations with functional differences or environmental adaptations
These analyses can provide insights into the evolution of photosynthetic systems and the specific adaptations of Pseudendoclonium akinetum.
Environmental factors can significantly impact the expression and function of Apocytochrome f in algal systems. Understanding these relationships is crucial for experimental design:
Environmental Factors Affecting Apocytochrome f:
| Environmental Factor | Observed Effect | Experimental Considerations |
|---|---|---|
| Light intensity | Altered expression levels and turnover rates | Control light conditions precisely during experiments |
| Nutrient availability | Changes in protein abundance and modification state | Standardize growth media composition |
| Temperature | Affects folding efficiency and stability | Maintain consistent temperature during expression and purification |
| Redox state | Impacts electron transfer efficiency | Monitor and control redox conditions in functional assays |
| CO2 levels | May alter photosynthetic complex stoichiometry | Consider CO2 availability in experimental design |
When designing experiments to study environmental effects, researchers should implement:
Controlled growth conditions with systematic variation of individual parameters
Time-course analyses to distinguish immediate responses from long-term adaptations
Correlation of protein-level changes with physiological and transcriptional responses
Consideration of post-translational regulatory mechanisms
Researchers working with Recombinant Pseudendoclonium akinetum Apocytochrome f often encounter specific challenges that require methodological solutions:
Common Challenges and Solutions:
Low Expression Yields:
Solution: Optimize codon usage for expression host, reduce induction temperature (16-18°C), co-express molecular chaperones
Improper Heme Incorporation:
Solution: Supplement growth media with δ-aminolevulinic acid (ALA), co-express cytochrome c maturation proteins, ensure reducing environment
Protein Aggregation:
Solution: Use mild detergents (0.03-0.1% DDM), add stabilizers like glycerol (10-20%), purify at 4°C, include reducing agents
Loss of Activity During Storage:
Solution: Store in buffer containing glycerol (20-25%) at -80°C, avoid repeated freeze-thaw cycles, aliquot before freezing
Difficulty in Reproducing Electron Transfer Measurements:
Solution: Standardize redox partner concentrations, control temperature and pH precisely, use consistent buffer composition
Implementing these methodological refinements can significantly improve the quality and reliability of research outcomes when working with this challenging protein.
When faced with contradictory results in studies involving Recombinant Pseudendoclonium akinetum Apocytochrome f, researchers should follow this systematic approach:
Evaluate Protein Quality: Confirm that all experiments used protein with equivalent purity, heme incorporation, and structural integrity
Examine Methodological Differences:
Buffer composition (pH, ionic strength, detergents)
Experimental conditions (temperature, reduction state)
Protein concentration and aggregation state
Presence of contaminating proteins or activities
Consider Biological Variability:
Different isoforms or splice variants
Post-translational modification heterogeneity
Differences in expression systems
Statistical Analysis:
Perform power analysis to ensure sufficient replication
Apply appropriate statistical tests for experimental design
Consider biological vs. technical replication
Validation Strategies:
Use orthogonal techniques to verify key findings
Perform carefully controlled side-by-side comparisons
Design experiments that can discriminate between competing hypotheses
This methodological approach to data interpretation helps resolve apparent contradictions and advances understanding of this complex protein.
To ensure reproducibility and reliability in research involving Recombinant Pseudendoclonium akinetum Apocytochrome f, publications should include comprehensive quality control metrics:
Essential Quality Control Parameters:
Protein Characterization:
SDS-PAGE and Western blot images demonstrating purity
UV-visible spectra showing characteristic cytochrome f absorption features
Mass spectrometry data confirming identity and modifications
Thermal stability assessment (e.g., DSF or CD thermal melt)
Functional Verification:
Redox potential measurements compared to literature values
Electron transfer activity with physiological partners
Binding affinity measurements with interaction partners
Experimental Controls:
Positive and negative controls for all functional assays
Non-functional mutants as specificity controls
Concentration-dependent effects to establish linear response ranges
Method Validation:
Calibration curves for quantitative measurements
Replicate analyses showing statistical variation
Comparisons with established reference materials when available
Data Reporting:
Complete methodological details for expression and purification
Buffer compositions including all additives
Raw data availability in appropriate repositories
Adherence to these quality control standards enhances the value and impact of research on this important photosynthetic protein.
Several cutting-edge technologies hold promise for deepening our understanding of Pseudendoclonium akinetum Apocytochrome f structure, function, and dynamics:
Cryo-Electron Microscopy: Single-particle analysis and tomography can reveal the structure of cytochrome f within the native cytochrome b6f complex at near-atomic resolution
Time-Resolved Spectroscopy: Ultrafast spectroscopic techniques can capture electron transfer events in real-time, providing insights into reaction mechanisms
Computational Approaches:
Molecular dynamics simulations of membrane integration and protein dynamics
Quantum mechanical calculations of electron transfer pathways
AlphaFold2 and other AI-based structure prediction tools for modeling variant effects
Single-Molecule Techniques:
FRET measurements to detect conformational changes during electron transfer
Force spectroscopy to probe protein stability and unfolding pathways
In-Cell NMR: Examining protein structure and dynamics in native-like environments
CRISPR-Based Approaches: Precise genome editing in algal systems to study cytochrome f function in vivo
These methodological advances promise to reveal new aspects of cytochrome f biology that have been previously inaccessible, particularly regarding dynamic processes and in vivo function.
Despite decades of research on cytochrome f, several important questions remain unresolved, particularly for the Pseudendoclonium akinetum protein:
Regulatory Mechanisms:
How is petA gene expression regulated in response to environmental cues?
What quality control mechanisms ensure proper cytochrome f assembly?
How is protein turnover regulated during photosynthetic acclimation?
Structural Dynamics:
What conformational changes occur during electron transfer?
How does the protein-protein interaction surface change in different redox states?
What is the role of the transmembrane domain in complex assembly and function?
Species-Specific Adaptations:
What structural features are unique to Pseudendoclonium akinetum Apocytochrome f?
How do these differences relate to the ecological niche of this organism?
Do alternative electron transfer pathways exist in stress conditions?
Evolutionary Questions:
Why has the petA gene been retained in the chloroplast genome while other components moved to the nucleus?
What selective pressures maintain the high conservation of cytochrome f?
Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and systems biology.