Recombinant Pseudendoclonium akinetum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Characteristics

  • Source: Pseudendoclonium akinetum (Green alga)

  • Gene Name: petA

  • Protein Names: Recommended name: Apocytochrome f

  • Sequence Info: Full length protein

  • AA Sequence: YPVFAQQGYKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQV QANGKKGDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNLYYQPYSSEQKNILVIGPIPG KLYNEMVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKIT EITPTGKKGGFDITIQTLNGETVIDKVPAGPELIVTKDQTIQVDQPLTNNPNVGGFGQAE AEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF

  • Expression Region: 45-329

  • Molecular Weight: The protein consists of 285 amino acids .

  • Tag Info: The tag type is determined during the production process .

  • Purity: Information regarding the purity level of the recombinant protein is not available.

  • Expression System: Information regarding the expression system used to produce the recombinant protein is not available.

  • Applications: ELISA

Structure and Function

Apocytochrome f is a critical component of the cytochrome $$b_6f$$ complex, a protein complex found in the thylakoid membranes of chloroplasts in green algae and plants . This complex mediates electron transfer between photosystem II and photosystem I during photosynthesis. Apocytochrome f specifically functions as an electron carrier, accepting electrons from plastoquinol (PQH2PQH_2) and donating them to plastocyanin .

Research and Applications

Due to its role in photosynthesis, Apocytochrome f has been a subject of interest in studies related to:

  • Photosynthetic Efficiency: Understanding the structure and function of Apocytochrome f can help in improving photosynthetic efficiency in algae and plants .

  • Algal Evolution: The mitochondrial DNA sequence of Pseudendoclonium akinetum, which contains the petA gene, has been studied to understand the evolutionary relationships between different green algae .

  • Biotechnology: Chloroplast genetic engineering has been used to express various proteins, including those involved in photosynthesis, for biotechnological applications such as herbicide, insect, and disease resistance, drought and salt tolerance, and phytoremediation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-329
Protein Length
Full Length of Mature Protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
petA
Target Protein Sequence
YPVFAQQGYKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQV QANGKKGDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNLYYQPYSSEQKNILVIGPIPG KLYNEMVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKIT EITPTGKKGGFDITIQTLNGETVIDKVPAGPELIVTKDQTIQVDQPLTNNPNVGGFGQAE AEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Pseudendoclonium akinetum?

Apocytochrome f is the precursor form of cytochrome f, a critical component of the cytochrome b6f complex that mediates electron transfer between photosystems II and I in the photosynthetic electron transport chain. In Pseudendoclonium akinetum, a green alga, the petA gene encodes this protein which, after processing and heme attachment, becomes functional cytochrome f. The mature protein contains approximately 285 amino acids (with the expression region spanning residues 45-329) and is essential for photosynthetic function . The protein's primary role is to transfer electrons from plastoquinol to plastocyanin in the thylakoid lumen, making it a crucial component for photosynthetic energy generation.

What structural features characterize Pseudendoclonium akinetum Apocytochrome f?

Pseudendoclonium akinetum Apocytochrome f has several key structural features essential for its function. Based on the amino acid sequence (YPVFAQQGYKNPREANGRIVCANCHLAQKPVELEVPQAVLPDTVFEAMVKIPYDQQIKQVQANGKKGDLNVGMVLILPEGFELAPSDRLPEEMKKKVGNLYYQPYSSEQKNILVIGPIPGKLYNEMVVPLISPNPATNKNVNYLKYPIYLGGNRGRGQLYPDGSKSNNNLYNASATGKITEITPTGKKGGFDITIQTLNGETVIDKVPAGPELIVTKDQTIQVDQPLTNNPNVGGFGQAEAEIVLQNPARVQGLIIFLITIFITQLFLVLKKKQVEKVQLAEMNF), it contains conserved cysteine residues involved in heme attachment and several domains critical for protein-protein interactions . Like other cytochrome f proteins, it likely has a large hydrophilic domain facing the thylakoid lumen, a single transmembrane anchor near the C-terminus, and a short stromal tail. Studies on related cytochrome f proteins suggest that the alpha-amino group of the N-terminal tyrosine (Tyr1) forms one of the axial ligands to the heme iron after signal sequence cleavage .

How does Apocytochrome f processing occur in algal systems?

Processing of Apocytochrome f involves several key steps that transform the inactive precursor into the functional cytochrome f. This multistep process includes:

  • Synthesis: The petA gene is transcribed and translated to produce pre-apocytochrome f

  • Membrane Targeting: The signal sequence directs the protein to the thylakoid membrane

  • Signal Sequence Cleavage: Thylakoid processing peptidase removes the signal sequence

  • Heme Attachment: Covalent ligation of c-type heme to specific cysteine residues by a heme lyase

  • Folding and Assembly: The protein adopts its final conformation and integrates into the cytochrome b6f complex

Research on Chlamydomonas reinhardtii has shown that heme binding is not a prerequisite for cytochrome f processing, indicating these steps can occur independently . The pre-apocytochrome f adopts a suitable conformation for cysteinyl residues to interact with heme lyase, and the pre-holocytochrome f folds into an assembly-competent conformation even when processing is delayed .

What expression systems are optimal for producing Recombinant Pseudendoclonium akinetum Apocytochrome f?

Selecting an appropriate expression system is crucial for obtaining functional Recombinant Pseudendoclonium akinetum Apocytochrome f. Researchers should consider these methodological approaches:

Expression System Selection Table:

Expression SystemAdvantagesLimitationsRecommended For
E. coliHigh yield, cost-effective, rapid growthMay lack proper folding machinery for algal proteinsStructure studies requiring high quantities
Yeast (e.g., Pichia pastoris)Post-translational modifications, higher eukaryoteSlower production than E. coliFunctional studies requiring proper folding
Algal systems (e.g., Chlamydomonas)Native-like folding and processingLower yield, more complex cultivationStudies focused on authentic protein interactions
Cell-free systemsRapid production, avoids toxicity issuesHigher cost, lower yieldPreliminary studies, toxic protein variants

For most applications, a modified E. coli system with co-expression of helper proteins for heme attachment (e.g., cytochrome c maturation proteins) is recommended, as this balances yield with proper protein processing. Expression should be optimized using low temperatures (16-18°C) and reduced inducer concentrations to promote proper folding of this complex protein.

What purification strategies yield the highest purity and activity of this recombinant protein?

Purification of Recombinant Pseudendoclonium akinetum Apocytochrome f requires a strategic approach to maintain structural integrity and functional activity:

  • Initial Extraction: Use gentle detergents (0.5-1% n-dodecyl-β-D-maltoside) for membrane-associated forms, or standard lysis buffers for soluble constructs

  • Affinity Chromatography: If tagged (often His-tag), use immobilized metal affinity chromatography (IMAC) with imidazole gradient elution

  • Ion Exchange Chromatography: Apply anion exchange (e.g., Q-Sepharose) at pH 8.0 to separate charged variants

  • Size Exclusion Chromatography: Final polishing step to separate monomeric protein from aggregates

  • Quality Control: Assess purity by SDS-PAGE and Western blot, confirm heme incorporation by spectroscopic analysis

Throughout purification, buffer conditions should include stabilizers (10-20% glycerol) and reducing agents (1-5 mM β-mercaptoethanol) to prevent oxidative damage and maintain protein stability. For structural studies, additional purification steps may be necessary to achieve >95% purity.

How can researchers verify the structural integrity of purified protein?

Verification of structural integrity is essential before proceeding with experiments. A comprehensive assessment should include:

Analytical Methods for Structural Verification:

  • UV-Visible Spectroscopy: Properly folded cytochrome f with attached heme shows characteristic absorption peaks at approximately 420 nm (Soret band) and 520-550 nm (α/β bands)

  • Circular Dichroism (CD): Confirms secondary structure content and proper folding

  • Mass Spectrometry: Verifies molecular weight and can identify post-translational modifications

  • Thermal Shift Assay: Evaluates protein stability and can help optimize buffer conditions

  • Functional Assays: Electron transfer activity using artificial electron donors/acceptors

  • Limited Proteolysis: Assesses tertiary structure by examining resistance to proteolytic degradation

These methods should be used in combination rather than relying on a single technique to confirm that the recombinant protein adopts a native-like conformation with proper heme incorporation.

What are the primary research applications for this recombinant protein?

Recombinant Pseudendoclonium akinetum Apocytochrome f serves as a valuable tool for multiple research applications:

  • Structural Biology: Crystallography and cryo-EM studies to determine high-resolution structures

  • Electron Transport Studies: Investigation of electron transfer mechanisms in photosynthetic systems

  • Protein-Protein Interaction Analysis: Identifying binding partners in the electron transport chain

  • Evolutionary Biology: Comparative studies between different algal species to trace photosynthetic evolution

  • Protein Folding Research: Understanding c-type cytochrome biogenesis and membrane protein insertion

  • Antibody Production: Generation of specific antibodies for detection of cytochrome f in native systems

  • Photosynthesis Research: Reconstitution experiments to study cytochrome b6f complex assembly and function

When designing experiments, researchers should consider the specific properties of Pseudendoclonium akinetum Apocytochrome f, including its redox potential, heme coordination, and membrane association characteristics.

What methodological approaches are recommended for studying protein-protein interactions?

To effectively study interactions between Recombinant Pseudendoclonium akinetum Apocytochrome f and other proteins, researchers should consider these methodological approaches:

Protein-Protein Interaction Methods Table:

MethodSensitivityIn vitro/In vivoAdvantagesLimitations
Co-immunoprecipitationModerateBothDetects native interactionsRequires high-quality antibodies
Pull-down assaysModerateIn vitroSimple, good for initial screeningMay detect non-physiological interactions
Surface Plasmon ResonanceHighIn vitroQuantitative kinetics and affinityRequires protein immobilization
Isothermal Titration CalorimetryHighIn vitroLabel-free, provides thermodynamic dataRequires significant protein amounts
Crosslinking Mass SpectrometryHighBothIdentifies interaction interfacesComplex data analysis
FRET/BRETHighIn vivoReal-time monitoring in living cellsRequires protein labeling
Yeast Two-HybridModerateIn vivoHigh-throughput screeningHigh false positive rate

When studying membrane proteins like cytochrome f, special consideration should be given to maintaining the native membrane environment or using appropriate detergents/nanodiscs to preserve protein conformation and interaction surfaces.

How can site-directed mutagenesis be applied to study functional domains?

Site-directed mutagenesis provides powerful insights into structure-function relationships of Pseudendoclonium akinetum Apocytochrome f. A methodical approach includes:

  • Target Selection: Identify conserved residues from sequence alignments with homologous proteins or from structural models

  • Mutagenesis Design:

    • Substitute heme-binding cysteines to confirm their role (similar to the study in Chlamydomonas where researchers replaced cysteinyl residues with valine and leucine)

    • Modify residues at the predicted plastocyanin binding site to investigate electron transfer

    • Alter processing site residues to study protein maturation

  • Expression and Analysis: Express mutants under identical conditions and perform comparative analyses of:

    • Heme incorporation (spectroscopic properties)

    • Protein stability (thermal denaturation)

    • Electron transfer rates (kinetic measurements)

    • Complex assembly (native gel electrophoresis)

    • Processing efficiency (western blotting)

This systematic approach allows researchers to build a comprehensive functional map of Pseudendoclonium akinetum Apocytochrome f domains and critical residues.

How do post-translational modifications affect the function of this protein?

Post-translational modifications (PTMs) significantly impact the maturation and function of Pseudendoclonium akinetum Apocytochrome f. The most critical modification is heme attachment, but other potential PTMs may include:

  • Signal Sequence Cleavage: Essential for proper protein localization and function, generating the N-terminal tyrosine that serves as a heme ligand

  • Heme Attachment: Covalent binding to conserved cysteine residues creates the functional c-type cytochrome

  • Potential Phosphorylation: May regulate protein-protein interactions or electron transfer efficiency

  • Membrane Insertion: Proper integration into the thylakoid membrane is crucial for function

Research on Chlamydomonas has demonstrated that cytochrome f can assemble into the cytochrome b6f complex even when processing of the precursor is delayed, but proper processing is ultimately required for optimal function . When investigating PTMs, researchers should employ a combination of mass spectrometry, site-directed mutagenesis, and functional assays to correlate specific modifications with functional outcomes.

What insights can comparative genomics provide about evolutionary conservation?

Comparative genomic analysis of the petA gene across algal species reveals important evolutionary patterns:

Evolutionary Conservation Analysis:

The petA gene encoding Apocytochrome f shows significant conservation across photosynthetic organisms, particularly in functional domains involved in electron transfer and protein-protein interactions. Key findings from comparative analyses include:

  • Domain Conservation: The heme-binding motif (CxxCH) is universally conserved across all photosynthetic organisms

  • Species-Specific Adaptations: Variable regions may reflect adaptations to different ecological niches

  • Evolutionary Rate: petA evolves more slowly than nuclear-encoded photosynthetic genes due to functional constraints

  • Horizontal Gene Transfer: Some algal lineages show evidence of horizontal gene transfer events affecting petA

Methodology for comparative analysis should include:

  • Multiple sequence alignment of petA sequences from diverse photosynthetic organisms

  • Phylogenetic tree construction to visualize evolutionary relationships

  • Calculation of selection pressures (dN/dS ratios) across different domains

  • Correlation of sequence variations with functional differences or environmental adaptations

These analyses can provide insights into the evolution of photosynthetic systems and the specific adaptations of Pseudendoclonium akinetum.

How do environmental factors influence expression and function?

Environmental factors can significantly impact the expression and function of Apocytochrome f in algal systems. Understanding these relationships is crucial for experimental design:

Environmental Factors Affecting Apocytochrome f:

Environmental FactorObserved EffectExperimental Considerations
Light intensityAltered expression levels and turnover ratesControl light conditions precisely during experiments
Nutrient availabilityChanges in protein abundance and modification stateStandardize growth media composition
TemperatureAffects folding efficiency and stabilityMaintain consistent temperature during expression and purification
Redox stateImpacts electron transfer efficiencyMonitor and control redox conditions in functional assays
CO2 levelsMay alter photosynthetic complex stoichiometryConsider CO2 availability in experimental design

When designing experiments to study environmental effects, researchers should implement:

  • Controlled growth conditions with systematic variation of individual parameters

  • Time-course analyses to distinguish immediate responses from long-term adaptations

  • Correlation of protein-level changes with physiological and transcriptional responses

  • Consideration of post-translational regulatory mechanisms

What are common challenges in working with this protein and how can they be overcome?

Researchers working with Recombinant Pseudendoclonium akinetum Apocytochrome f often encounter specific challenges that require methodological solutions:

Common Challenges and Solutions:

  • Low Expression Yields:

    • Solution: Optimize codon usage for expression host, reduce induction temperature (16-18°C), co-express molecular chaperones

  • Improper Heme Incorporation:

    • Solution: Supplement growth media with δ-aminolevulinic acid (ALA), co-express cytochrome c maturation proteins, ensure reducing environment

  • Protein Aggregation:

    • Solution: Use mild detergents (0.03-0.1% DDM), add stabilizers like glycerol (10-20%), purify at 4°C, include reducing agents

  • Loss of Activity During Storage:

    • Solution: Store in buffer containing glycerol (20-25%) at -80°C, avoid repeated freeze-thaw cycles, aliquot before freezing

  • Difficulty in Reproducing Electron Transfer Measurements:

    • Solution: Standardize redox partner concentrations, control temperature and pH precisely, use consistent buffer composition

Implementing these methodological refinements can significantly improve the quality and reliability of research outcomes when working with this challenging protein.

How should researchers interpret conflicting experimental data?

When faced with contradictory results in studies involving Recombinant Pseudendoclonium akinetum Apocytochrome f, researchers should follow this systematic approach:

  • Evaluate Protein Quality: Confirm that all experiments used protein with equivalent purity, heme incorporation, and structural integrity

  • Examine Methodological Differences:

    • Buffer composition (pH, ionic strength, detergents)

    • Experimental conditions (temperature, reduction state)

    • Protein concentration and aggregation state

    • Presence of contaminating proteins or activities

  • Consider Biological Variability:

    • Different isoforms or splice variants

    • Post-translational modification heterogeneity

    • Differences in expression systems

  • Statistical Analysis:

    • Perform power analysis to ensure sufficient replication

    • Apply appropriate statistical tests for experimental design

    • Consider biological vs. technical replication

  • Validation Strategies:

    • Use orthogonal techniques to verify key findings

    • Perform carefully controlled side-by-side comparisons

    • Design experiments that can discriminate between competing hypotheses

This methodological approach to data interpretation helps resolve apparent contradictions and advances understanding of this complex protein.

What quality control metrics should be used when publishing research?

To ensure reproducibility and reliability in research involving Recombinant Pseudendoclonium akinetum Apocytochrome f, publications should include comprehensive quality control metrics:

Essential Quality Control Parameters:

  • Protein Characterization:

    • SDS-PAGE and Western blot images demonstrating purity

    • UV-visible spectra showing characteristic cytochrome f absorption features

    • Mass spectrometry data confirming identity and modifications

    • Thermal stability assessment (e.g., DSF or CD thermal melt)

  • Functional Verification:

    • Redox potential measurements compared to literature values

    • Electron transfer activity with physiological partners

    • Binding affinity measurements with interaction partners

  • Experimental Controls:

    • Positive and negative controls for all functional assays

    • Non-functional mutants as specificity controls

    • Concentration-dependent effects to establish linear response ranges

  • Method Validation:

    • Calibration curves for quantitative measurements

    • Replicate analyses showing statistical variation

    • Comparisons with established reference materials when available

  • Data Reporting:

    • Complete methodological details for expression and purification

    • Buffer compositions including all additives

    • Raw data availability in appropriate repositories

Adherence to these quality control standards enhances the value and impact of research on this important photosynthetic protein.

What emerging technologies might advance our understanding of this protein?

Several cutting-edge technologies hold promise for deepening our understanding of Pseudendoclonium akinetum Apocytochrome f structure, function, and dynamics:

  • Cryo-Electron Microscopy: Single-particle analysis and tomography can reveal the structure of cytochrome f within the native cytochrome b6f complex at near-atomic resolution

  • Time-Resolved Spectroscopy: Ultrafast spectroscopic techniques can capture electron transfer events in real-time, providing insights into reaction mechanisms

  • Computational Approaches:

    • Molecular dynamics simulations of membrane integration and protein dynamics

    • Quantum mechanical calculations of electron transfer pathways

    • AlphaFold2 and other AI-based structure prediction tools for modeling variant effects

  • Single-Molecule Techniques:

    • FRET measurements to detect conformational changes during electron transfer

    • Force spectroscopy to probe protein stability and unfolding pathways

  • In-Cell NMR: Examining protein structure and dynamics in native-like environments

  • CRISPR-Based Approaches: Precise genome editing in algal systems to study cytochrome f function in vivo

These methodological advances promise to reveal new aspects of cytochrome f biology that have been previously inaccessible, particularly regarding dynamic processes and in vivo function.

What unresolved questions remain about this protein's function and regulation?

Despite decades of research on cytochrome f, several important questions remain unresolved, particularly for the Pseudendoclonium akinetum protein:

  • Regulatory Mechanisms:

    • How is petA gene expression regulated in response to environmental cues?

    • What quality control mechanisms ensure proper cytochrome f assembly?

    • How is protein turnover regulated during photosynthetic acclimation?

  • Structural Dynamics:

    • What conformational changes occur during electron transfer?

    • How does the protein-protein interaction surface change in different redox states?

    • What is the role of the transmembrane domain in complex assembly and function?

  • Species-Specific Adaptations:

    • What structural features are unique to Pseudendoclonium akinetum Apocytochrome f?

    • How do these differences relate to the ecological niche of this organism?

    • Do alternative electron transfer pathways exist in stress conditions?

  • Evolutionary Questions:

    • Why has the petA gene been retained in the chloroplast genome while other components moved to the nucleus?

    • What selective pressures maintain the high conservation of cytochrome f?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and systems biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.