Recombinant Pseudendoclonium akinetum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Composition and Production

The recombinant atpI protein corresponds to residues 1–247 of the native chloroplast subunit (UniProt ID: Q3ZIZ6) and is expressed in Escherichia coli with an N-terminal His tag for purification . Key production details include:

ParameterSpecification
Host SystemE. coli
TagN-terminal His tag
PurityPurified via affinity chromatography
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C
ApplicationsStructural studies, enzyme kinetics, antibody production

3.1. Mutational and Regulatory Studies

  • Knockout Phenotypes: Deletion of atpI in algae disrupts ATP synthase assembly, leading to loss of phototrophic growth and mitochondrial genome instability .

  • Post-Transcriptional Regulation: MTHI1 enhances atpI mRNA translation by binding its 5′ untranslated region (UTR), illustrating tight post-transcriptional control .

  • Proteolytic Processing: While not directly observed in P. akinetum, related chloroplast proteases (e.g., ClpP1) process subunits in other algae, suggesting potential maturation steps for functional atpI .

3.2. Evolutionary Context

  • Genomic Features: The P. akinetum chloroplast genome retains an inverted repeat (IR) structure, with atpI located outside this region . Comparative genomics reveals IR loss trends in Ulvophyceae, impacting gene organization .

Biotechnological Applications

  • Enzyme Mechanism Studies: Recombinant atpI enables structural analyses (e.g., cryo-EM) to elucidate proton channel dynamics .

  • Drug Discovery: As ATP synthase is a target for antimicrobials and anticancer agents, this subunit aids in screening inhibitors targeting Fo proton translocation .

  • Diagnostic Tools: An ELISA kit (CBM15 Cat. CSB-CF671373PDAV) utilizes this protein for antibody detection, though commercial availability is currently limited .

Challenges and Future Directions

  • Expression Optimization: Improving soluble yields in E. coli remains a hurdle due to atpI’s hydrophobic transmembrane domains .

  • Functional Complementation: Heterologous expression in mutant algae could validate atpI’s role in ATP synthase assembly and proton coupling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
atpI
Target Protein Sequence
MVDKIMNSTANLLFDFAEVSVGQHYYWQIGEYSVHGQVLMTSWFVFAVIAILSIAGNRDL KAIPEGLQNLTEYITEFIRDLAKTQIGEEEYVKWIPFLGTLFLFIFVSNWSGALIPWHIF EIPNGELAAPTNDINTTVALALLTSTAYFYAGFSKKGLGYFKRYVSPAAFLLPINVLEDF TKPLSLSFRLFGNILADELVVGVLVALVPLVVPIPIMLLGLFTSGIQALVFATLAGAYIG ESIEDHH
Uniprot No.

Target Background

Function
This protein serves as a key component of the proton channel and plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Pseudendoclonium akinetum ATP synthase subunit a and its role in chloroplasts?

ATP synthase subunit a (atpI) is a critical component of the F₀ sector of the chloroplastic ATP synthase complex in P. akinetum (now also known as Tupiella akineta). This integral membrane protein forms part of the proton channel that couples proton flow to the mechanical rotation necessary for ATP synthesis.

The protein consists of 247 amino acids and functions within the thylakoid membrane to facilitate proton movement driven by the electrochemical gradient (ΔμH+) established during photosynthesis. This proton flux drives the rotation of the c-ring, which is mechanically coupled to conformational changes in the F₁ sector that catalyze ATP synthesis from ADP and inorganic phosphate (Pi) .

ATP synthase operates through a chemiosmotic mechanism where the energy from proton flux driven by ΔμH+ (composed of both electric potential Δψ and pH gradient ΔpH components) is converted to the chemical energy of the phosphate bond in ATP . The subunit a plays a crucial role in this energy conversion process by forming part of the proton-conducting pathway.

Storage Recommendations:

Recombinant atpI protein is typically supplied as a lyophilized powder and should be stored according to these guidelines:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage requires -20°C/-80°C with glycerol added as a cryoprotectant

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage

  • Create multiple small aliquots to minimize freeze-thaw cycles

  • The reconstituted protein is supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0

Repeated freeze-thaw cycles should be strictly avoided as they can significantly reduce protein activity and accelerate degradation .

What expression system is used for producing recombinant P. akinetum atpI?

Recombinant P. akinetum ATP synthase subunit a is typically expressed in Escherichia coli expression systems. The protein is produced as a fusion with an N-terminal His-tag to facilitate purification using affinity chromatography .

E. coli is the preferred expression host for this membrane protein due to several advantages:

  • High yield of protein expression

  • Well-established protocols for membrane protein expression

  • Compatibility with His-tag purification systems

  • Ability to grow in defined media for isotopic labeling if needed for structural studies

  • Scalable production systems from laboratory to industrial scales

The expression process involves transformation of an E. coli strain with a plasmid containing the atpI gene sequence optimized for bacterial expression, followed by induction of protein expression, typically using IPTG or auto-induction systems .

What approaches are recommended for functional reconstitution of atpI into liposomes?

Reconstitution of ATP synthase components, including atpI, into liposomes provides a valuable system for studying their function in a membrane environment. Based on established methodologies for ATP synthase components, the following approach is recommended:

  • Preparation of Liposomes:

    • Use a mixture of phospholipids (typically phosphatidylcholine and phosphatidic acid at a 9:1 ratio)

    • Create unilamellar vesicles through extrusion or sonication

    • Size the liposomes to approximately 100-200 nm diameter

  • Protein Incorporation:

    • Solubilize the purified recombinant atpI in a suitable detergent (e.g., n-dodecyl β-D-maltoside)

    • Mix with preformed liposomes at a lipid-to-protein ratio of 50:1 to 100:1

    • Remove detergent through dialysis or adsorption onto Bio-Beads

  • Verification of Reconstitution:

    • Assess protein orientation using protease protection assays

    • Confirm incorporation using density gradient centrifugation

    • Examine proteoliposome morphology using electron microscopy

For functional studies, these atpI-containing proteoliposomes can be used in proton translocation assays. Typically, this involves creating a pH gradient or membrane potential across the liposome membrane and monitoring changes using pH-sensitive fluorescent dyes or electrodes .

Studies with ATP synthase components have demonstrated that a minimal ΔμH+ of 210 mV and optimal ΔμH+ of 290 mV is required for ATP synthesis, with the H+-conducting activity being proportional to the imposed ΔμH+ .

How can researchers verify the function of recombinant atpI in experimental settings?

Verifying the function of recombinant atpI requires assessing its ability to participate in proton translocation within the ATP synthase complex. Several complementary approaches can be employed:

  • Proton Flux Measurements:

    • Reconstitute atpI with other ATP synthase components in liposomes

    • Create a pH gradient across the membrane (e.g., acid-base transition from pH 5.5 to 8.4)

    • Monitor proton movement using pH-sensitive dyes or a pH meter

    • Quantify the rate of H+ conductance (e.g., 6H+/sec/103 mV at pH 8.0 has been observed in similar systems)

  • Electrical Measurements:

    • Incorporate reconstituted ATP synthase containing atpI into planar lipid bilayers

    • Measure electric current using electrodes on both sides of the membrane

    • Apply ATP to initiate proton pumping and record the resulting current

    • Analyze the kinetics following Michaelis-Menten parameters (Km of approximately 0.14 mM for ATP has been observed)

  • ATP Synthesis Assay:

    • Create a proton gradient across proteoliposomes containing ATP synthase with atpI

    • Add ADP and Pi to the reaction mixture

    • Measure ATP production using luciferase assay or HPLC

    • Confirm ATP synthesis is sensitive to protonophores and ATP synthase inhibitors

ATP synthesis can be induced either by imposing a pH gradient (ΔpH) through acid-base transition or by creating an electrical potential (Δψ) using external electric pulses (e.g., 760 V/cm, 30 ms) .

What methodologies are available for studying atpI interactions with other ATP synthase components?

Understanding the interaction between atpI and other ATP synthase components is crucial for elucidating the structure-function relationship of this complex. Several methodologies are recommended:

These approaches provide complementary information about how atpI interacts with other components, particularly the c-ring subunits that form the rotor in the membrane-embedded F₀ sector.

How does chloroplastic atpI differ from mitochondrial ATP synthase subunit a?

Chloroplastic and mitochondrial ATP synthase subunit a share functional similarities but exhibit significant structural and evolutionary differences:

FeatureChloroplastic atpI (P. akinetum)Mitochondrial ATP synthase subunit a
Length247 amino acids Typically 220-270 amino acids (species-dependent)
Membrane organizationMultiple transmembrane segmentsMultiple transmembrane segments
Genetic originEncoded by chloroplast genome (atpI gene) Encoded by mitochondrial genome (ATP6 gene)
Evolutionary originCyanobacterial endosymbiontAlpha-proteobacterial endosymbiont
Proton pathwayContains conserved arginine residue for proton translocationSimilar proton translocation mechanism
Inhibitor sensitivityInsensitive to oligomycinTypically sensitive to oligomycin
ConservationHighly conserved among photosynthetic organismsHighly conserved among eukaryotes

What are the challenges in expressing and purifying functional recombinant atpI?

Expressing and purifying recombinant atpI presents several challenges due to its hydrophobic nature as a membrane protein. Researchers should be aware of these challenges and consider the following technical solutions:

  • Protein Aggregation:

    • Challenge: Tendency for atpI to form insoluble aggregates during expression

    • Solution: Express at lower temperatures (16-20°C), use specialized E. coli strains (C41/C43), and optimize inducer concentration

  • Toxic Effects:

    • Challenge: Expression may be toxic to host cells due to membrane disruption

    • Solution: Use tightly controlled inducible promoters, consider auto-induction systems, and optimize expression duration

  • Detergent Selection:

    • Challenge: Finding detergents that maintain protein structure and function

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations for optimal solubilization while maintaining function

  • Purification Optimization:

    • Challenge: Obtaining high purity while preserving activity

    • Solution: Utilize two-step purification with immobilized metal affinity chromatography followed by size exclusion chromatography

  • Protein Stability:

    • Challenge: Maintaining stability during storage and handling

    • Solution: Add stabilizing agents (glycerol, trehalose) and avoid repeated freeze-thaw cycles

The purified protein from successful preparations should achieve >90% purity as determined by SDS-PAGE analysis . It is essential to verify that the protein retains its native conformation and is capable of integration into membranes for functional studies.

How can recombinant atpI be used for structural studies of ATP synthase?

Recombinant atpI provides an excellent tool for structural studies of the ATP synthase complex, offering several advantages and methodological approaches:

These structural approaches can be complemented by computational methods such as molecular dynamics simulations to understand the dynamic behavior of atpI within the membrane environment and its interactions with other ATP synthase components.

What are the recommended approaches for designing site-directed mutagenesis studies of atpI?

Site-directed mutagenesis of atpI is a powerful approach for understanding structure-function relationships. The following methodological framework is recommended:

How can chloroplast transformation technologies be applied to study atpI in vivo?

Chloroplast transformation provides powerful tools for studying atpI function in its native environment. Based on methodologies used for other chloroplast genes, the following approach is recommended:

  • Vector Design for Chloroplast Transformation:

    • Create a species-specific vector with:

      • Left and right flanking regions (~0.8 kb each) for homologous recombination

      • Endogenous promoters (e.g., 16S rRNA promoter)

      • 5' and 3' UTRs from chloroplast genes

      • Selectable marker gene (e.g., aadA conferring spectinomycin resistance)

      • The modified atpI gene with desired mutations or tags

  • Transformation Methodology:

    • Prepare DNA-coated gold particles for biolistic delivery

    • Optimize bombardment parameters (helium pressure, distance, vacuum)

    • Culture bombarded cells on selective medium (e.g., containing spectinomycin 400 mg/L)

    • Screen for transformants using PCR and confirm homoplasmy

  • Verification of Transgene Integration:

    • Confirm integration using PCR with gene-specific primers

    • Verify homoplasmy using Southern blot analysis

    • Quantify chloroplast genome copy number using droplet digital PCR

    • Sequence the integration site to confirm precise recombination

  • Functional Analysis:

    • Assess photosynthetic efficiency and ATP synthesis rates

    • Measure growth rates under various conditions

    • Compare ATP synthase activity between wild-type and transformed lines

    • Analyze protein expression levels using western blotting

The chloroplast genome typically exhibits multiple copies per cell, facilitating higher expression levels of transgenes compared to nuclear transformation . This approach allows for precise manipulation of atpI in its native context to study its function and interactions in vivo.

How does P. akinetum atpI compare with ATP synthase subunits from other algal species?

The ATP synthase subunit a from P. akinetum shows both conservation and divergence when compared to homologs from other algal species:

The conserved regions typically include the amino acids involved in proton translocation and interfaces with other ATP synthase components, reflecting functional constraints. Divergent regions often correspond to species-specific adaptations or interactions with regulatory factors .

Molecular phylogenetic analysis places P. akinetum atpI in a clade with other green algal homologs, consistent with its taxonomic classification. The divergence patterns observed in algal atpI sequences provide insights into the evolutionary history of these organisms and the adaptation of the ATP synthase complex to different environmental conditions.

What evolutionary insights can be gained from studying atpI in P. akinetum?

Studying the atpI gene and protein in P. akinetum provides several evolutionary insights:

  • Endosymbiotic Origin:

    • The chloroplastic atpI gene in P. akinetum reflects its cyanobacterial ancestry

    • Comparison with cyanobacterial homologs reveals conservation of core functional domains

    • This supports the endosymbiotic theory of chloroplast origin

  • Gene Transfer and Retention:

    • Unlike many chloroplast genes that transferred to the nucleus during evolution

    • atpI has been retained in the chloroplast genome in P. akinetum and other algae

    • This retention suggests constraints on nuclear transfer, possibly due to:

      • Hydrophobicity of the protein

      • Challenges in re-importing

      • Coordination of expression with other chloroplast genes

  • Selective Pressures:

    • Patterns of conservation reflect functional constraints on proton translocation

    • Variable regions suggest adaptation to specific environmental conditions

    • The conservation of key residues across diverse photosynthetic organisms highlights their critical functional roles

  • Coevolution with Other Subunits:

    • Comparative analysis reveals coordinated evolution with other ATP synthase components

    • Interface regions show complementary changes across interacting subunits

    • This coevolution maintains structural and functional integrity of the complex

These evolutionary insights contribute to our understanding of chloroplast evolution, the adaptation of bioenergetic systems, and the constraints on gene transfer during endosymbiotic organelle evolution .

How can recombinant atpI contribute to understanding ATP synthase assembly and function?

Recombinant atpI serves as a valuable tool for investigating ATP synthase assembly and function:

  • Assembly Process Studies:

    • Use fluorescently labeled recombinant atpI to track incorporation into the complex

    • Identify assembly intermediates through pull-down assays with tagged atpI

    • Determine the sequence and kinetics of assembly steps

    • Identify assembly factors that interact specifically with atpI

  • Subunit Interface Analysis:

    • Introduce cross-linkable residues at predicted interfaces between atpI and other subunits

    • Map interaction surfaces through cross-linking and mass spectrometry

    • Verify essential contacts through mutagenesis of interface residues

    • Develop models of subunit arrangement based on interaction data

  • Proton Pathway Mapping:

    • Introduce mutations in predicted proton-conducting residues

    • Measure effects on proton translocation and ATP synthesis

    • Use chemical probes to map accessibility of residues in the assembled complex

    • Construct detailed models of the proton translocation mechanism

  • Regulatory Mechanism Exploration:

    • Investigate how modifications of atpI affect ATP synthase regulation

    • Examine interactions with regulatory factors

    • Study the effects of physiological regulators (pH, ions) on atpI conformation

    • Develop sensor systems using modified atpI to monitor ATP synthase activity in real-time

This systematic approach using recombinant atpI contributes to a comprehensive understanding of ATP synthase function, which has implications for both basic science and potential biotechnological applications in bioenergetics.

What are the current limitations in atpI research and future directions?

Current research on P. akinetum atpI faces several limitations that suggest important directions for future investigation:

  • Structural Limitations:

    • Challenge: Limited high-resolution structural data on algal ATP synthase complexes

    • Future direction: Apply advanced cryo-EM techniques to determine the structure of the entire complex with atpI in its native environment

  • Functional Characterization Gaps:

    • Challenge: Incomplete understanding of species-specific functional adaptations

    • Future direction: Comparative functional studies across diverse algal species to elucidate evolutionary adaptations

  • Integration with Systems Biology:

    • Challenge: Limited understanding of how atpI function integrates with broader cellular processes

    • Future direction: Multi-omics approaches to connect ATP synthase function with metabolic networks and stress responses

  • Technical Barriers:

    • Challenge: Difficulties in expressing and purifying sufficient quantities of functional protein

    • Future direction: Develop improved expression systems and membrane protein purification methods

  • In Vivo Analysis Limitations:

    • Challenge: Limited tools for manipulating atpI in its native context

    • Future direction: Expand chloroplast transformation technologies to more algal species and develop inducible systems for temporal control of gene expression

Addressing these limitations will advance our understanding of ATP synthase function and evolution, with potential applications in synthetic biology, bioenergy research, and the development of algal biotechnology platforms.

How can atpI research contribute to broader applications in biotechnology?

Research on P. akinetum atpI has several potential applications in biotechnology:

  • Bioenergy Applications:

    • Enhanced ATP production in engineered algae could improve biomass and lipid yields

    • Optimized ATP synthase could increase photosynthetic efficiency

    • Engineered algae with modified atpI might better tolerate stress conditions relevant to biofuel production

  • Biosensor Development:

    • Modified atpI proteins could serve as sensors for proton gradients or membrane potential

    • Integration into synthetic biology circuits for monitoring cellular energetics

    • Development of screening systems for compounds affecting bioenergetic processes

  • Protein Engineering Platforms:

    • Lessons from atpI structure-function relationships could inform design of synthetic transmembrane proteins

    • Engineered proton channels based on atpI design principles

    • Development of novel energy-converting membrane protein complexes

  • Pharmaceutical Applications:

    • Understanding atpI function could help identify targets for algal-specific inhibitors

    • Potential applications in controlling harmful algal blooms

    • Comparative studies with human ATP synthase could inform development of drugs targeting human disorders

  • Agricultural Applications:

    • Knowledge of atpI function could contribute to engineering photosynthetic efficiency in crops

    • Understanding stress responses in ATP synthase could inform development of stress-tolerant crops

    • Improved photosynthetic efficiency could enhance crop yields under suboptimal conditions

These applications highlight the broader significance of fundamental research on ATP synthase components like atpI beyond their immediate scientific interest .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.