Recombinant Pseudendoclonium akinetum ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

ATP synthase, also known as F0F1-ATPase, is a ubiquitous enzyme that produces adenosine triphosphate (ATP), the primary energy currency in cells . It harnesses the proton gradient across a membrane to catalyze ATP synthesis from adenosine diphosphate (ADP) and inorganic phosphate . In plants and algae, ATP synthase is found in both mitochondria and chloroplasts, playing a vital role in energy production during cellular respiration and photosynthesis, respectively . The ATP synthase complex comprises several subunits, each with specific functions. Among these subunits is subunit b (atpF), which is crucial for the enzyme's structural integrity and function.

Pseudendoclonium akinetum and its ATP Synthase

Pseudendoclonium akinetum is a species of green alga known for its unique cellular and molecular characteristics. Like other photosynthetic organisms, P. akinetum utilizes ATP synthase in its chloroplasts to generate ATP during the light-dependent reactions of photosynthesis . The ATP synthase in P. akinetum shares similarities with that of other green algae, such as Chlamydomonas reinhardtii, but also possesses distinct features .

Structure and Function of ATP Synthase Subunit b (atpF)

The subunit b (atpF) of ATP synthase is a critical component of the F0 sector, which is embedded in the thylakoid membrane of chloroplasts. It forms part of the stalk that connects the F0 sector to the F1 sector, the catalytic portion of the enzyme.

  • Structural Role Subunit b is essential for stabilizing the ATP synthase complex, ensuring proper interaction between the F0 and F1 sectors. It participates in the assembly of the enzyme and helps maintain its structural integrity during ATP synthesis .

  • Functional Role Functionally, subunit b is involved in proton translocation. It facilitates the flow of protons (H+) across the thylakoid membrane, which drives the rotation of the c-ring in the F0 sector. This rotation, in turn, powers the conformational changes in the F1 sector that lead to ATP synthesis .

Recombinant Production of P. akinetum ATP Synthase Subunit b (atpF)

Recombinant production involves using genetic engineering techniques to express the atpF gene in a host organism, such as E. coli, to produce large quantities of the protein .

  • Cloning and Expression The atpF gene from P. akinetum is isolated and inserted into an expression vector. This vector is then introduced into a host organism, where the atpF gene is transcribed and translated, resulting in the production of the subunit b protein.

  • Purification The recombinant subunit b protein is purified using various chromatographic methods, such as affinity chromatography or ion exchange chromatography. This ensures that the protein is isolated from other cellular components and is suitable for downstream applications.

Research Findings and Significance

Research on recombinant Pseudendoclonium akinetum ATP synthase subunit b has provided valuable insights into the structure, function, and evolution of ATP synthase in green algae.

  • Comparative Studies By comparing the atpF sequence and structure from P. akinetum with those of other organisms, researchers can identify conserved regions and unique features. These comparisons help elucidate the evolutionary relationships between different ATP synthases and provide clues about the functional importance of specific amino acid residues .

  • Functional Analysis Recombinant atpF can be used in in vitro assays to study its role in ATP synthase activity. For example, site-directed mutagenesis can be employed to create atpF variants with specific amino acid changes. By analyzing the effects of these mutations on ATP synthesis, researchers can gain a better understanding of the subunit's functional mechanisms .

  • Structural Studies The recombinant protein can be used for structural studies, such as X-ray crystallography or cryo-electron microscopy. These techniques provide high-resolution images of the atpF subunit, revealing its three-dimensional structure and interactions with other subunits in the ATP synthase complex .

Tables of Data

FeatureDescription
Protein NameRecombinant Pseudendoclonium akinetum ATP synthase subunit b, chloroplastic (atpF)
Source OrganismPseudendoclonium akinetum
FunctionStructural and functional component of ATP synthase in chloroplasts; involved in proton translocation and stabilization of the enzyme complex.
Molecular WeightVaries depending on post-translational modifications; typically ranges from 15-25 kDa.
Recombinant Expression HostEscherichia coli (commonly used)
Purification MethodsAffinity chromatography, ion exchange chromatography
ApplicationsStructural studies (X-ray crystallography, cryo-EM), functional assays (ATP synthesis measurements), evolutionary comparisons.
Unique FeaturesMay exhibit unique structural characteristics compared to other algal or plant ATP synthase subunit b proteins, potentially related to adaptation to specific environmental conditions or photosynthetic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
atpF
Target Protein Sequence
MNFIPISLIFSGHGFGFNTNIFETNVINLAVVIGVVVSFVGDAVRELLKNRKETIVNNLR EADNRALEAQEKLSQAKAQLADAQKKATEIREQGLVAAEQEKKLCIKQAEEDAARLKQVQ QDTIRFQQQKAIQQISQQIVSLALQQVRQKLKMGASAPFHVSVNKSKIDLFKRSL
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-embedded proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic context of the atpF gene in Pseudendoclonium akinetum chloroplast?

The atpF gene in P. akinetum is located within its chloroplast genome, which has been fully sequenced and exhibits unusual structural features compared to other green algae. The P. akinetum chloroplast genome contains inverted repeats (IR) with a size of approximately 6.0 kb, which is the smallest among the studied Ulvophyceae species . These IR sequences divide the genome into distinct single copy regions, creating a quadripartite structure. The atpF gene is likely contained within one of these single copy regions, similar to the organization seen in other green algae. The entire chloroplast genome of P. akinetum is approximately 195,867 bp, with a G+C content of 31.5% .

How does the atpF gene structure in P. akinetum differ from other green algae?

In P. akinetum, like many other chloroplast genes, the atpF gene may contain introns, as the organism's chloroplast genome is known to contain 27 group I introns, which is considerably higher than many other ulvophycean algae . Based on comparative genomics of ulvophycean species, there may be structural variations in the atpF gene that reflect the evolutionary history of this gene within green algae. The gene content and organization in P. akinetum represent adaptations that have occurred during its evolution within the Ulotrichales order .

What is the function of ATP synthase subunit b in chloroplast energy metabolism?

ATP synthase subunit b (atpF) forms an essential part of the F₀ portion of the chloroplastic ATP synthase complex, which is embedded in the thylakoid membrane. This subunit functions as part of the peripheral stalk that connects the membrane-embedded F₀ portion to the catalytic F₁ portion. The peripheral stalk acts as a stator, preventing the α₃β₃ hexamer from rotating with the central rotor during ATP synthesis. The proton gradient established during photosynthesis drives the rotation of the c-subunit ring within the membrane, which is mechanically coupled to the rotation of the γ-subunit within the F₁ portion . This rotational force drives the synthesis of ATP from ADP and inorganic phosphate at the catalytic sites. The subunit b is therefore crucial for maintaining the structural integrity and proper function of the entire ATP synthase complex.

What expression systems are most effective for recombinant production of P. akinetum atpF?

Based on established protocols for similar chloroplast proteins, the most effective expression system for recombinant P. akinetum atpF would likely be a bacterial system using Escherichia coli. For membrane proteins like atpF, specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for membrane protein expression, may yield better results.

A fusion protein approach, similar to that used for subunit c in spinach chloroplast ATP synthase, can be employed . This would involve:

  • Cloning the atpF gene into an expression vector with a fusion tag (such as maltose-binding protein, MBP)

  • Transforming the construct into an appropriate E. coli strain

  • Inducing expression under optimized conditions (temperature, IPTG concentration, duration)

  • Cell harvesting and membrane isolation

The fusion with MBP can improve solubility and facilitate purification, while the inclusion of a protease cleavage site allows for subsequent removal of the tag .

What purification strategies overcome the challenges of isolating membrane-associated atpF?

Purification of membrane-associated proteins like atpF requires specialized approaches:

  • Membrane Solubilization: Using appropriate detergents (such as n-dodecyl β-D-maltoside or n-octyl glucoside) to solubilize the membranes without denaturing the protein

  • Affinity Chromatography: Utilizing the fusion tag (e.g., MBP) for initial purification on an amylose resin

  • Tag Cleavage: Removing the fusion tag using a specific protease

  • Size Exclusion Chromatography: Further purifying the protein based on size

  • Ion Exchange Chromatography: Final polishing step to achieve high purity

When working with recombinant atpF, it's crucial to verify proper folding after purification using circular dichroism spectroscopy to confirm the expected alpha-helical secondary structure, similar to the approach used for subunit c .

How can researchers optimize protein yield while maintaining structural integrity of atpF?

Optimizing protein yield while maintaining structural integrity requires careful balancing of expression conditions:

ParameterOptimization RangeImpact on Protein
Temperature16-30°CLower temperatures (16-20°C) often improve folding
Induction Time3-24 hoursLonger at lower temperatures, shorter at higher temperatures
IPTG Concentration0.1-1.0 mMLower concentrations may improve folding
Media CompositionLB, TB, M9Rich media (TB) typically improves yield
Addition of Detergents0.1-1%Helps solubilize membrane proteins during expression

Inclusion of membrane-stabilizing agents (glycerol, specific lipids) in purification buffers can help maintain structural integrity. Avoid harsh detergents and extreme pH conditions that might denature the protein. Using a fusion partner that enhances solubility, such as MBP, can significantly improve both yield and proper folding .

What techniques are most suitable for determining the structure of recombinant P. akinetum atpF?

Multiple complementary techniques should be employed for comprehensive structural characterization:

  • Circular Dichroism (CD) Spectroscopy: For determination of secondary structure elements (alpha-helices, beta-sheets)

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For solution structure determination if the protein can be isotopically labeled

  • X-ray Crystallography: If the protein can be crystallized, potentially as part of a larger complex

  • Cryo-Electron Microscopy: Especially valuable for visualizing atpF in the context of the entire ATP synthase complex

  • Hydrogen-Deuterium Exchange Mass Spectrometry: For probing protein dynamics and solvent accessibility

For membrane proteins like atpF, structural studies often require reconstitution into lipid nanodiscs or liposomes to mimic the native membrane environment, which is crucial for maintaining physiologically relevant conformations.

How does the P. akinetum atpF interact with other ATP synthase subunits during complex assembly?

The interaction of atpF with other ATP synthase subunits is likely to follow patterns similar to those observed in other chloroplast ATP synthases, with some species-specific variations:

  • Subunit b (atpF) forms dimers that extend from the membrane as part of the peripheral stalk

  • These dimers interact with subunit delta (atpD) at the top of the peripheral stalk

  • The peripheral stalk connects to the alpha/beta hexamer of the F₁ portion

  • At the membrane level, subunit b interacts with subunit a (atpI) and potentially with the c-ring

Interaction studies can be performed using techniques such as:

  • Co-immunoprecipitation with antibodies against atpF

  • Cross-linking studies followed by mass spectrometry to identify interacting partners

  • Yeast two-hybrid or bacterial two-hybrid assays for specific protein-protein interactions

  • Surface plasmon resonance (SPR) for binding kinetics

The unique evolutionary position of P. akinetum may result in specific adaptations in these interaction interfaces that differ from those in higher plants or other algae.

What is the proton-to-ATP ratio in P. akinetum ATP synthase and how does it compare to other species?

The proton-to-ATP ratio in ATP synthase is determined by the number of c-subunits in the c-ring, as each c-subunit translocates one proton during rotation. For every complete rotation of the c-ring, three ATP molecules are synthesized (one at each of the three catalytic sites) .

While the exact number of c-subunits in P. akinetum ATP synthase hasn't been directly determined in the provided search results, we can make educated comparisons:

Organismc-subunits per ringH⁺/ATP ratio
Spinach chloroplast144.67
Cyanobacteria13-154.33-5.0
E. coli103.33
Yeast mitochondria103.33
Mammalian mitochondria82.67

Based on its evolutionary position, P. akinetum likely has a c-ring with 13-15 subunits, resulting in a H⁺/ATP ratio between 4.33-5.0. This higher ratio compared to mitochondrial ATP synthases reflects adaptation to the typically lower proton motive force available in chloroplasts. Experimental determination would require isolation of intact ATP synthase complexes and structural studies of the c-ring.

How can site-directed mutagenesis of P. akinetum atpF inform our understanding of ATP synthase evolution?

Site-directed mutagenesis of P. akinetum atpF can provide valuable insights into ATP synthase evolution by:

  • Conserved Residue Analysis: Mutating highly conserved residues that are present across diverse species to determine their functional significance

  • Lineage-Specific Adaptations: Identifying and mutating residues unique to ulvophycean algae to understand adaptation to specific ecological niches

  • Structural Flexibility Study: Creating mutations that alter the predicted flexibility of the peripheral stalk to understand mechanical requirements

  • Evolutionary Rate Analysis: Comparing the tolerance to mutations between atpF regions that evolve at different rates

The approach would involve:

  • Bioinformatic analysis to identify targets for mutagenesis

  • Creating a library of point mutations using PCR-based methods

  • Expressing and characterizing mutant proteins

  • Assessing functional impact through reconstitution experiments

These studies could reveal how P. akinetum ATP synthase has adapted to its specific environmental conditions and provide insights into the evolutionary constraints on this essential enzyme complex.

What methods can be used to study the impact of IR sequence variations on atpF gene expression in P. akinetum?

The presence of divergent inverted repeat (IR) sequences in the P. akinetum chloroplast genome may influence gene expression, including that of atpF. To study these effects, researchers can use:

  • Quantitative RT-PCR: To measure atpF transcript levels under different conditions

  • Reporter Gene Assays: Constructing chimeric genes where atpF regulatory regions are fused to reporter genes like GFP or luciferase

  • Chloroplast Transformation: Introducing modified IR sequences through chloroplast transformation to directly assess their impact

  • RNA-Seq Analysis: For genome-wide expression studies to identify co-regulated genes

  • DNA-Protein Interaction Studies: Using techniques like electrophoretic mobility shift assays (EMSA) to identify proteins that interact with IR sequences

It's particularly relevant to study how the flip-flop recombination between IR copies, which has been documented in other ulvophycean algae like Ignatius but not in species like Pseudoneochloris , might affect atpF expression. This recombination process creates genomic isomers with different relative orientations of the single-copy regions, potentially affecting gene context and expression.

How can recombinant P. akinetum atpF be incorporated into artificial membrane systems for bioenergetic studies?

Incorporation of recombinant P. akinetum atpF into artificial membrane systems enables sophisticated bioenergetic studies:

  • Liposome Reconstitution:

    • Preparation of liposomes from phospholipids (typically DOPC/POPE mixtures)

    • Incorporation of purified atpF along with other ATP synthase subunits

    • Formation of proteoliposomes with oriented protein insertion

  • Nanodiscs Construction:

    • Assembly of membrane scaffold protein (MSP) with phospholipids and atpF

    • Creation of uniform nanodiscs containing single or few protein complexes

    • Advantage of greater stability and accessibility compared to liposomes

  • Planar Lipid Bilayers:

    • Formation of artificial bilayers across apertures

    • Incorporation of atpF-containing complexes

    • Allows for precise electrical measurements

  • Experimental Measurements:

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • ATP synthesis measurements under defined proton gradients

    • Patch-clamp studies for measuring proton conductance

    • Single-molecule fluorescence studies to observe conformational changes

These systems allow researchers to study how the unique features of P. akinetum atpF affect ATP synthase function under controlled conditions, potentially revealing adaptations specific to this alga's environmental niche.

What are the common challenges in expressing recombinant P. akinetum atpF and how can they be addressed?

Common challenges and solutions include:

ChallengePotential Solutions
Poor expressionTry different promoters (T7, tac); optimize codon usage for E. coli; lower induction temperature (16-20°C)
Protein aggregationExpress as fusion with solubility tags (MBP, SUMO); add low concentrations of detergents during cell lysis
Proteolytic degradationUse protease-deficient host strains; add protease inhibitors; optimize extraction conditions
Improper membrane insertionUse specialized expression strains like C41(DE3); include lipids in culture media
Difficulty in purificationDesign optimized purification tags; screen different detergents for solubilization

A systematic approach to optimization is crucial, testing multiple conditions in parallel and carefully analyzing each step in the expression and purification process. Establishing robust quality control checkpoints throughout the workflow helps identify and address issues early.

How can researchers verify the functional integrity of purified recombinant atpF?

Verifying functional integrity requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular dichroism to confirm proper secondary structure (predominantly alpha-helical)

    • Size exclusion chromatography to verify proper oligomeric state

    • Limited proteolysis to test for correct folding (properly folded proteins show resistance to digestion)

  • Binding Studies:

    • Interaction assays with purified partner subunits (e.g., delta subunit)

    • Co-sedimentation assays to test membrane association

    • Fluorescence-based binding assays using labeled interaction partners

  • Functional Reconstitution:

    • Integration into liposomes with other ATP synthase components

    • Testing whether the reconstituted complex can generate proton gradients or synthesize ATP

    • Comparison with wild-type or control proteins from well-characterized species

The gold standard for functional verification would be reconstitution of the full ATP synthase complex with the recombinant atpF and demonstration of ATP synthesis activity driven by a proton gradient.

How might P. akinetum atpF be utilized in synthetic biology applications?

P. akinetum atpF could be utilized in several innovative synthetic biology applications:

  • Designer Energy Systems:

    • Engineering hybrid ATP synthases with components from different species

    • Creating ATP synthases with altered H⁺/ATP ratios for specific energy applications

    • Developing light-driven ATP production systems for synthetic cells

  • Biosensors:

    • Developing sensors for proton gradients across membranes

    • Creating detection systems for membrane potential changes

    • Engineering reporter systems for ATP production levels

  • Drug Delivery Systems:

    • Using modified ATP synthase components to create nanomotors

    • Developing environmentally responsive membrane protein systems

    • Engineering protein pores with controlled gating properties

  • Biofuel Applications:

    • Creating systems that couple proton gradients to different energy-requiring processes

    • Engineering more efficient energy conversion systems in artificial photosynthesis

    • Developing ATP regeneration systems for biocatalysis

The unique structural features of P. akinetum atpF, adapted to its specific evolutionary context, might provide advantages in certain applications compared to more commonly studied ATP synthase components.

What insights might comparative genomics between P. akinetum and other ulvophycean algae provide about atpF evolution?

Comparative genomic analysis between P. akinetum and other ulvophycean algae can reveal:

  • Evolutionary Rate Variations:

    • Whether atpF evolves at different rates across ulvophycean lineages

    • If genes in single copy regions evolve faster than those in IR regions, as observed in other species

    • Whether there are lineage-specific selection pressures on atpF

  • Gene Context Conservation:

    • How the genomic neighborhood of atpF has changed across evolutionary time

    • Whether gene rearrangements have affected atpF expression or function

    • If atpF has experienced different recombination events in different lineages

  • Correlation with Ecological Adaptations:

    • Whether atpF sequence variations correlate with habitat preferences

    • If specific adaptations in atpF are associated with particular environmental conditions

    • How differences in chloroplast genomic architecture (such as IR arrangement) might influence atpF function

The chloroplast genomes of ulvophycean algae show significant structural diversity, with variations in genome size (96-263 kb), gene content, and intron abundance . These variations provide a natural laboratory for studying how essential genes like atpF adapt and evolve under different genomic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.