Recombinant Pseudendoclonium akinetum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference when placing your order, and we will prepare accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to blue ice packs. Should you require dry ice, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
cemA
Target Protein Sequence
MSNNSSTSFKNQKPVEPIGIIPRSIIRTFNRFIIQLFPNSNALVIQEFRISRYQVFVSIQ CLLSLIFIPLIITFLSKTFVFLPLTEYVWNTQTDDIFLNSYLEKEALSELQDFEEQLYFD YFVSPNTYETPNWASYQISTDSSSQLESSFNNFPEILKSEIQKKTLELATHYNQKSIESL TNLFSDFVSFGTFALLVIILKPQIIILKSFLIESIYSLSDTIKSFLLILGTDLLVGFHSP RGWELFLEFVLNRFGFPHDENFIFLFVATLPVLLDTVFKYWIFRYLNKISPSTVATYHAM LE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of cemA in Pseudendoclonium akinetum?

The cemA gene in Pseudendoclonium akinetum is part of the chloroplast genome, which has been fully sequenced and analyzed as part of broader studies into chlorophyte genomic evolution . The gene encodes a chloroplast envelope membrane protein that serves important functions in the photosynthetic apparatus. Within the Pseudendoclonium chloroplast genome, cemA exists as a single open reading frame (ORF) without the splitting observed in some genes like rpoB and rpoC1 in other algal species . The genomic environment features various repeated elements characteristic of the Pseudendoclonium chloroplast genome, particularly short dispersed repeats (SDRs) that map to intergenic spacers and introns .

How does the cemA gene in Pseudendoclonium compare to other green algae?

Comparative genomic analysis reveals notable size variations in the cemA gene across different green algal species. In Pseudendoclonium akinetum, the cemA gene spans 909 base pairs (bp), representing an expansion of 1.8 times relative to its homolog in Mesostigma . This places Pseudendoclonium in an intermediate position when compared to other chlorophytes: Chlorella displays a cemA gene of 801 bp (1.6x expansion relative to Mesostigma), while Chlamydomonas exhibits a significantly larger cemA gene of 1,503 bp (3.0x expansion) . This comparative data suggests evolutionary processes leading to gene expansion in the chlorophyte lineage, with Pseudendoclonium representing an intermediate stage in this expansion process.

What experimental approaches are used to isolate and sequence the Pseudendoclonium akinetum chloroplast genome?

The isolation and sequencing of the Pseudendoclonium akinetum chloroplast genome involved a multistep methodology. The alga was cultured in modified Volvox medium under controlled 12-hour light-dark cycles . Researchers isolated an A+T-rich fraction containing chloroplast DNA (cpDNA) and mitochondrial DNA (mtDNA) using established protocols . After isolation, the DNA was sequenced and the sequences were subsequently edited and assembled using SEQUENCHER 4.2.1 software . For validation of specific genomic regions, the research team employed PCR amplification, particularly to confirm the structure of repeated elements that might be prone to deletion during cloning in Escherichia coli . This methodological approach allowed for accurate determination of the genome structure including the cemA gene region.

What mechanisms contribute to the expansion of coding regions in Pseudendoclonium cemA compared to other algal species?

The expansion of coding regions in Pseudendoclonium akinetum's chloroplast genes, including cemA, represents a complex evolutionary phenomenon. Analysis of the cemA gene reveals it is 1.8 times larger than its counterpart in Mesostigma . While eight protein-coding genes in Pseudendoclonium exhibit significant expansion, cemA appears unique in that its expansion appears to involve mechanisms beyond simple coding region enlargement, which is the primary cause of increased size in other genes like ftsH and rpo genes .

The expansion mechanisms likely involve multiple evolutionary processes, including the acquisition of additional functional domains, insertion of repeat elements, and potential recruitment of foreign genetic material. Comparative analysis with Chlamydomonas, where cemA exhibits a 3.0x expansion relative to Mesostigma, suggests that cemA expansion may represent an ongoing evolutionary process in chlorophytes, with Pseudendoclonium representing an intermediate stage . Further investigation would require detailed sequence analysis to identify specific inserted sequences and functional domains that contribute to the observed expansion.

How do the repeated elements in the Pseudendoclonium chloroplast genome potentially impact cemA expression and function?

The Pseudendoclonium akinetum chloroplast genome contains numerous repeated elements that could potentially impact gene expression and function, including that of cemA . Two distinct types of repeats have been identified: short tandem repeats and short dispersed repeats (SDRs) . The SDRs, classified into four groups (A, B, C, and D) based on primary sequences, frequently occur as palindromic sequences capable of forming stem-loop structures, which could affect RNA stability and processing .

Intriguingly, many of these SDRs show identical or close sequence similarity to those present in the mitochondrial genome of Pseudendoclonium . This unexpected sharing of repeat elements between organellar genomes suggests potential regulatory crosstalk or historical genetic exchange. The presence of these repeated elements near genes like cemA might influence transcriptional efficiency, RNA processing, or post-transcriptional regulation. Research into how these structural elements affect cemA expression would require detailed transcriptomic analysis and potentially in vitro studies of RNA secondary structure formation and stability.

What comparative approaches can resolve the evolutionary trajectory of cemA expansion in green algal lineages?

Resolving the evolutionary trajectory of cemA expansion across green algal lineages requires sophisticated comparative approaches. Based on the available data showing cemA sizes across Chlorella (801 bp), Pseudendoclonium (909 bp), and Chlamydomonas (1,503 bp), researchers can employ several complementary methods :

  • Phylogenetic reconstruction incorporating cemA sequence data from additional green algal species, particularly those representing key evolutionary transitions.

  • Comparative sequence analysis to identify specific expansion "hotspots" within the gene, determining whether expansions occurred in functional domains or intervening regions.

  • Selective constraint analysis to assess whether expanded regions are under purifying, neutral, or positive selection.

  • Structural biology approaches to determine how protein structure may be affected by gene expansions.

  • Functional complementation studies using recombinant cemA variants of different sizes to assess functional equivalence.

These approaches collectively would help determine whether cemA expansion represents an adaptive evolutionary process or neutral genetic drift, and whether the intermediate size of Pseudendoclonium cemA reflects its phylogenetic position or convergent evolution.

What expression systems are most suitable for producing recombinant Pseudendoclonium akinetum cemA for structural and functional studies?

Based on the structural characteristics of the cemA gene in Pseudendoclonium akinetum, several expression systems merit consideration for recombinant protein production. The cemA gene encodes a chloroplast envelope membrane protein, which presents challenges for heterologous expression due to its membrane-associated nature .

For structural studies, expression constructs should incorporate purification tags that minimally interfere with protein folding and function. Given the intermediate size of Pseudendoclonium cemA (909 bp) compared to Chlamydomonas (1,503 bp), it may serve as an advantageous model for structural studies, potentially offering better crystallization properties than its larger homologs .

What techniques can effectively analyze the role of cemA in Pseudendoclonium akinetum photosynthesis?

Investigating the functional role of cemA in Pseudendoclonium akinetum photosynthesis requires a multi-faceted approach combining genetic, biochemical, and biophysical techniques. Given that direct genetic manipulation protocols may not be established for Pseudendoclonium akinetum, researchers might employ heterologous systems and comparative analyses:

  • Comparative phenotypic analysis with cemA mutants in model organisms like Chlamydomonas where genetic tools are well-established.

  • Recombinant expression and reconstitution experiments to assess protein-protein interactions with other photosynthetic components.

  • Chlorophyll fluorescence analysis to assess photosystem efficiency in the presence of wild-type versus modified cemA.

  • Membrane fractionation and proteomic analysis to determine cemA's precise localization and interaction partners within the chloroplast envelope.

  • Structural studies using techniques like cryo-electron microscopy to resolve the protein's arrangement within membrane complexes.

The intermediate size of Pseudendoclonium cemA (909 bp compared to 1,503 bp in Chlamydomonas) might provide advantages in these analyses, potentially simplifying structural determination while maintaining functional relevance .

How can researchers validate the predicted secondary structure and membrane topology of the Pseudendoclonium cemA protein?

Validating the predicted secondary structure and membrane topology of the Pseudendoclonium akinetum cemA protein requires integrating computational predictions with experimental validation. The following methodological approach would be appropriate:

  • Initial computational prediction using multiple topology prediction algorithms specialized for membrane proteins, taking into account the moderate size of Pseudendoclonium cemA (909 bp) relative to other green algal homologs .

  • Experimental validation through techniques such as:

    • Cysteine-scanning mutagenesis followed by accessibility studies

    • Protease protection assays on isolated chloroplast envelope membranes

    • Fluorescence resonance energy transfer (FRET) analysis with strategically placed fluorophores

    • Limited proteolysis followed by mass spectrometry to identify exposed regions

  • Cross-validation with structural data from homologous proteins where available, considering the evolutionary relationship between Pseudendoclonium cemA and other algal cemA proteins demonstrated in comparative genomic studies .

  • In vitro translation and membrane insertion assays to analyze the efficiency and orientation of membrane integration.

This integrated approach would provide robust validation of predicted structures while acknowledging the unique characteristics of the Pseudendoclonium cemA protein.

What insights does the comparative analysis of cemA genes across green algal lineages reveal about functional adaptation?

Comparative analysis of cemA genes across green algal lineages provides valuable insights into functional adaptation and evolutionary pressures. The significant size variation observed—from Mesostigma (used as the reference point) to Chlorella (801 bp, 1.6x expansion), Pseudendoclonium (909 bp, 1.8x expansion), and Chlamydomonas (1,503 bp, 3.0x expansion)—suggests differential selective pressures across lineages .

This size variation pattern raises several important questions about functional adaptation. The expansion appears to follow phylogenetic relationships to some degree, with the more derived chlorophyte Chlamydomonas showing greater expansion than Pseudendoclonium . This pattern may reflect adaptation to different ecological niches or photosynthetic requirements. Alternatively, it might represent neutral evolution with variable constraints on gene size in different lineages.

To distinguish between these possibilities, researchers should conduct detailed analysis of:

  • Selection signatures across different regions of the gene

  • Correlation between expansion patterns and ecological factors

  • Functional conservation versus innovation in expanded regions

The intermediate position of Pseudendoclonium cemA makes it particularly valuable as a comparative reference point for understanding the trajectory of functional adaptation in this gene family .

How do intron patterns in the Pseudendoclonium chloroplast genome inform our understanding of cemA evolution?

While cemA itself does not appear among the genes specifically mentioned as containing introns in Pseudendoclonium akinetum, the intron patterns observed in the chloroplast genome provide important context for understanding cemA evolution. The Pseudendoclonium chloroplast genome contains numerous introns with complex evolutionary relationships .

Particularly noteworthy is the finding of homologous introns inserted at identical positions in both chloroplast and mitochondrial genes (specifically noted for atpA and atp1) . This suggests potential mobility of intronic elements between organellar genomes. Additionally, several Pseudendoclonium chloroplast introns share high sequence and structural similarity with introns in chlorophycean green algae, particularly Chlamydomonas reinhardtii .

These patterns suggest several important considerations for cemA evolution:

  • Even though cemA may not currently contain introns in Pseudendoclonium, the gene exists in a genomic environment with active intron mobility

  • The evolutionary trajectory of cemA likely involved episodes of intron gain and loss

  • The size variation observed in cemA across green algal lineages might partially reflect historical intron events, even if not preserved in current gene structures

Comparative analysis of cemA across species with varying intron content could reveal whether intron dynamics contributed to the observed size expansion patterns .

What are the potential applications of recombinant Pseudendoclonium akinetum cemA in enhancing photosynthetic efficiency in biotechnology?

The intermediate size and potentially unique structural properties of Pseudendoclonium akinetum cemA present interesting possibilities for biotechnological applications aimed at enhancing photosynthetic efficiency. The cemA gene in Pseudendoclonium (909 bp) represents an evolutionary intermediate between smaller versions like Chlorella (801 bp) and larger ones like Chlamydomonas (1,503 bp) .

This intermediate form might offer optimal functional characteristics that could be leveraged in several ways:

  • Engineering more efficient carbon concentration mechanisms in crop plants, potentially improving photosynthetic efficiency under varying CO2 conditions.

  • Developing synthetic biology approaches to enhance algal biofuel production by optimizing inorganic carbon uptake and utilization.

  • Creating chimeric cemA proteins that combine functional domains from different algal lineages to achieve novel properties or enhanced performance.

  • Establishing Pseudendoclonium cemA as a model system for structure-function studies of membrane proteins involved in photosynthesis.

The comparative genomic data showing Pseudendoclonium cemA's intermediate expansion state (1.8x relative to Mesostigma) suggests it may represent an evolutionary "sweet spot" between the minimal functional unit and the more complex forms seen in derived lineages . This characteristic could make it particularly valuable as a biotechnological chassis.

What are the most promising research avenues for understanding the relationship between cemA gene expansion and functional innovation?

Future research into the relationship between cemA gene expansion and functional innovation should focus on several key avenues:

  • Structural biology approaches: Determining the three-dimensional structure of cemA proteins from species representing different expansion states (e.g., Chlorella, Pseudendoclonium, and Chlamydomonas) would reveal how the additional sequence in expanded versions contributes to protein structure and potentially function .

  • Functional complementation studies: Testing whether the differentially sized cemA genes can functionally complement each other in heterologous systems would help determine if expansion has led to functional divergence or simply structural elaboration of the same core function.

  • Domain-swapping experiments: Creating chimeric cemA proteins with domains from different species would help identify which regions contribute to specific functional properties.

  • Comparative transcriptomics and proteomics: Analyzing expression patterns and protein interaction networks across species with differently sized cemA genes would reveal whether expansion correlates with changes in regulation or interaction partners.

  • Evolutionary rate analysis: Detailed analysis of selection patterns across different regions of cemA genes would help distinguish between neutral expansion and adaptive evolution.

The intermediate position of Pseudendoclonium cemA (909 bp compared to 801 bp in Chlorella and 1,503 bp in Chlamydomonas) makes it particularly valuable as a reference point in these comparative studies .

How might advanced sequencing and structural analysis techniques resolve outstanding questions about Pseudendoclonium akinetum cemA?

Advanced sequencing and structural analysis techniques offer promising approaches to resolve several outstanding questions about Pseudendoclonium akinetum cemA:

  • Long-read sequencing technologies (Oxford Nanopore, PacBio) could provide improved resolution of repeat-rich regions surrounding cemA, potentially uncovering regulatory elements that influence expression.

  • Single-molecule real-time sequencing might reveal whether the cemA gene contains any post-transcriptional modifications that affect its expression or function.

  • Cryo-electron microscopy could determine the structure of cemA within its native membrane environment, particularly valuable given cemA's role as a chloroplast envelope membrane protein.

  • Hydrogen-deuterium exchange mass spectrometry could map flexible regions and interaction surfaces of the cemA protein, providing insights into how the expanded regions in Pseudendoclonium cemA (909 bp) compared to Chlorella (801 bp) contribute to protein dynamics .

  • AlphaFold2 and other AI-based structural prediction tools could generate comparative models of cemA across species with different expansion states, providing testable hypotheses about structure-function relationships.

These advanced techniques, when applied in a comparative framework that leverages the intermediate expansion state of Pseudendoclonium cemA, could significantly advance our understanding of how evolutionary expansion of this gene relates to functional innovation in the chloroplast envelope.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.