Recombinant Pseudendoclonium akinetum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction

The cytochrome b6f complex is an enzyme present in the thylakoid membrane of chloroplasts in plants, green algae, and cyanobacteria . This complex plays a vital role in photosynthesis by catalyzing the transfer of electrons from plastoquinol to plastocyanin . Simultaneously, it pumps protons into the thylakoid space, creating an electrochemical gradient that drives ATP synthesis .

The Pseudendoclonium akinetum Cytochrome b6-f complex subunit 4 (petD) is a subunit of this complex. The cytochrome b6f complex is essential for both linear and cyclic electron transport during oxygenic photosynthesis .

Structure and Composition

The cytochrome b6f complex exists as a dimer, with each monomer consisting of eight subunits . These subunits include four large subunits and four small subunits .

The large subunits are:

  • A 32 kDa cytochrome f with a c-type cytochrome

  • A 25 kDa cytochrome b6 with a low- and high-potential heme group

  • A 19 kDa Rieske iron-sulfur protein containing a [2Fe-2S] cluster

  • A 17 kDa subunit IV (petD)

The small subunits are:

The total molecular weight of the complex is 217 kDa .

Cytochrome b6f contains seven prosthetic groups. Four are found in both cytochrome b6f and bc1: the c-type heme of cytochrome c1 and f, the two b-type hemes (bp and bn) in bc1 and b6f, and the [2Fe-2S] cluster of the Rieske protein. Three unique prosthetic groups are found in cytochrome b6f: chlorophyll a, β-carotene, and heme cn (also known as heme x) .

Function and Catalytic Role

The subunit IV (petD) plays a catalytic role in the chloroplast cytochrome b6-f complex . Trypsinolysis, the digestion of a protein by trypsin, of the complex inactivates the complex by 80% after seven minutes of incubation . This inactivation is accompanied by the destruction of the proton translocation activity of the complex .

Subunit IV is the only subunit in the cytochrome b6-f complex digested by trypsin, and the degree of digestion correlates with the decrease of electron transfer activity . The binding of azido-Q to subunit IV of the complex decreases as the extent of inactivation of the cytochrome b6-f complex by trypsin increases . The residue molecular mass of trypsin-cleaved subunit IV is about 14 kDa, suggesting that the cleavage site is at lysine 119 or arginine 125 or 126 .

Role of PetM

PetM is essential for the stabilization and function of the cytochrome b6f complex in Arabidopsis . PetM is required by Arabidopsis to maintain the function of the cyt b6f complex, likely through its close link with core subunits to form a tight 'fence' that stabilizes the core of the complex .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
petD
Target Protein Sequence
MAVIKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVIFGSFACVIGLAVLDPA AVGEPANPFATPLEILPEWYFYPTFQLLRTVPNKLLGVLLMAAVPAGLLTVPFIENINKF QNPFRRPIATTVFLIGTFAAIWLGIGACLPIDISLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.