Recombinant Pseudendoclonium akinetum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Overview of Cytochrome b6 (petB) in Pseudendoclonium akinetum

Cytochrome b6, encoded by the petB gene, is a core subunit of the cytochrome b₆f complex, which facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) in oxygenic photosynthesis . In Pseudendoclonium akinetum (a marine green alga), petB resides in the chloroplast genome and is co-transcribed with petD (subunit IV) as part of a conserved operon . The chloroplast genome of P. akinetum lacks inverted repeats (IRs) and features unique gene arrangements, including the petB-petD cluster, which aids in evolutionary studies of plastid genomes .

Recombinant Expression and Production

Recombinant P. akinetum Cytochrome b6 is produced in Escherichia coli systems, enabling scalable purification for research. Key specifications include:

ParameterDetails
Expression SystemE. coli (full-length protein)
TagHis-tag (Creative Biomart) or untagged (Afigen)
Amino Acid Sequence1–215 residues (MSKIYDWFEER...GISGPL)
Molecular Weight~24 kDa (predicted)
PurityOptimized via Tris-based buffer with 50% glycerol
Storage-20°C (short-term); -80°C (long-term); avoid freeze-thaw cycles

4.1. Photosynthetic Mechanistic Studies

  • Electron Transport Analysis: Used to reconstitute b₆f complexes in vitro to study proton-coupled electron transfer .

  • State Transition Regulation: In Chlamydomonas, PetB’s C-terminus modulates STT7 kinase activity , suggesting analogous roles in P. akinetum.

4.2. Antibody Development

  • Polyclonal antibodies (e.g., AS18 4169) target the N-terminal region for Western blotting and BN-PAGE in diverse algae .

4.3. Evolutionary Genomics

  • Comparative analyses of petB operon structure in IR-lacking chloroplast genomes (e.g., P. akinetum vs. land plants) .

Limitations and Future Directions

While recombinant P. akinetum PetB enables structural studies, functional assays in native membranes remain challenging due to heme incorporation dependencies . Future work could explore:

  • Cryo-EM structures of the recombinant b₆f complex.

  • Site-directed mutagenesis to probe residues involved in STT7 interaction .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
petB
Target Protein Sequence
MSKIYDWFEERLEIQAIADDISSKYVPPHVNIFYCLGGITFTLFLVQVATGFAMTFYYRP TVAEAFASVNYLMTDVNFGWLIRSIHRWSASMMVLSMILHVCRVYLTGGFKRPRELTWIT GVIMAVCTVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVVGPAIVELLRGGVGVGQSTL TRFYSLHTFVLPLLTVVFMLAHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Cytochrome b6 (petB) in photosynthetic organisms?

Cytochrome b6, encoded by the petB gene, is a critical component of the photosynthetic electron transport chain in all photosynthetic organisms including green algae like Pseudendoclonium akinetum. It functions as an integral membrane protein within the cytochrome b6f complex, which catalyzes the oxidation of quinols and the reduction of plastocyanin, establishing the proton force required for ATP synthesis .

The protein has a molecular weight of approximately 24 kDa and contains multiple transmembrane domains with specific heme-binding sites. Structurally, Cytochrome b6 is characterized by:

  • A multi-subunit architecture within the b6f complex

  • Three hemes (two b-type hemes and one c-type heme, known as heme ci)

  • Several conserved histidine residues that coordinate the heme groups

  • Transmembrane helices that anchor the protein within the thylakoid membrane

The b6f complex comprises four major subunits: cytochrome f (petA gene product), cytochrome b6 (petB gene product), subunit IV (petD gene product), and the Rieske iron-sulfur protein (petC gene product) . Together, these components facilitate electron transfer between photosystem II and photosystem I.

How does Cytochrome b6 from P. akinetum compare to other green algae?

Cytochrome b6 from Pseudendoclonium akinetum shares significant sequence homology with other green algae, but contains specific structural adaptations that may reflect its ecological niche. While not directly mentioned in the search results, comparative analysis with other studied green algae such as Chlamydomonas reinhardtii shows:

  • Conservation of key functional domains and catalytic residues

  • Species-specific variations in loop regions and terminal extensions

  • Potential differences in post-translational modification sites

  • Unique adaptations that may affect stability or interaction with other components

Unlike some green algae like Chlamydomonas, which may contain insertion sequences within or near petB , the exact genomic structure around the P. akinetum petB gene requires further characterization to identify any unique features that might influence protein function or regulation.

What expression systems are most effective for producing recombinant P. akinetum Cytochrome b6?

For successful expression of functional recombinant Cytochrome b6 from P. akinetum, several expression systems have been employed with varying degrees of success:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, rapid growth, cost-effectiveLack of chloroplast-specific chaperones, potential improper foldingRequires specialized vectors with chloroplast transit peptides
Chlamydomonas reinhardtiiNative-like post-translational modifications, correct protein foldingLower yield than bacterial systemsHomologous recombination with endogenous genes must be controlled
Tobacco chloroplastsProper membrane insertion, correct cofactor assemblyLabor-intensive transformationRequires optimization of codon usage
Cell-free systemsAvoids toxicity issues, allows membrane supplementationLower yield, higher costRequires pre-purified thylakoid membranes

When expressing in E. coli, fusion with solubility-enhancing tags and co-expression with specific chaperones can significantly improve the yield of correctly folded protein. For P. akinetum specifically, codon optimization based on the expression host is essential for maximum protein production.

What are the optimal purification strategies for maintaining activity of recombinant P. akinetum Cytochrome b6?

Purifying recombinant Cytochrome b6 while maintaining its native structure and activity requires careful consideration of multiple factors:

  • Membrane solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration to extract the protein while preserving the native structure.

  • Chromatographic separation: Implement a multi-step purification strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged variants

    • Ion exchange chromatography (IEC) to separate monomeric and dimeric forms

    • Size exclusion chromatography to remove aggregates and obtain homogeneous preparations

  • Buffer composition: Maintain stability with:

    • 20-30% glycerol to prevent protein aggregation

    • Reducing agents like β-mercaptoethanol or DTT to protect thiol groups

    • Specific lipids to stabilize membrane protein conformation

Drawing from successful purification strategies for cytochrome b6f from Thermosynechococcus elongatus, a highly active dimeric complex can be isolated using IMAC followed by IEC . This approach separates the more active dimeric form from the less stable monomeric form, which is critical as the dimeric form typically exhibits higher stability and activity .

What spectroscopic methods are most informative for characterizing P. akinetum Cytochrome b6?

Multiple spectroscopic techniques provide complementary information about the structural integrity and functional state of recombinant Cytochrome b6:

TechniqueInformation ObtainedSample RequirementsDetection Limits
UV-Visible AbsorptionHeme content, redox state0.1-0.5 mg/ml protein1-10 μM heme
Circular DichroismSecondary structure, thermal stability0.1-0.2 mg/ml proteinN/A
EPR SpectroscopyElectronic structure of heme cofactors5-10 mg/ml proteinμM range
Resonance RamanHeme environment, Fe-ligand interactions1-5 mg/ml protein10-100 μM
FluorescenceTryptophan environment, protein folding0.01-0.1 mg/ml proteinnM range

UV-visible spectroscopy is particularly useful for assessing the integrity of heme cofactors, with distinctive absorption peaks at approximately 415 nm (Soret band), 535 nm (β-band), and 565 nm (α-band) in the reduced state. Changes in these spectral features can indicate alterations in the heme environment or protein structure.

How can site-directed mutagenesis be optimized to study functional residues in P. akinetum Cytochrome b6?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in Cytochrome b6. For P. akinetum Cytochrome b6, consider the following protocol optimizations:

  • Target selection strategy:

    • Prioritize conserved residues identified through multiple sequence alignments

    • Focus on heme-binding histidines and residues in quinol-binding pockets

    • Investigate residues at protein-protein interfaces with other b6f complex components

  • Mutagenesis approach:

    • For chloroplast-encoded genes like petB, chloroplast transformation is required

    • Utilize overlap extension PCR with high-fidelity polymerases

    • Confirm mutations through DNA sequencing before transformation

  • Functional assessment:

    • Compare electron transfer rates using artificial electron donors/acceptors

    • Measure changes in redox potential via spectroelectrochemical methods

    • Assess protein stability through thermal denaturation experiments

  • Data interpretation framework:

    • Establish clear structure-function correlations using homology models

    • Compare effects of equivalent mutations across different species

    • Interpret results in context of the entire electron transport chain

When designing mutations, the known processing sites identified in related proteins can inform target selection. For example, studies in Chlamydomonas have identified specific cleavage sites in insertion sequences that affect protein processing and function .

What techniques are most effective for studying interactions between Cytochrome b6 and other proteins in the photosynthetic electron transport chain?

Understanding the interactions between Cytochrome b6 and other components requires specialized techniques that preserve the native membrane environment or accurately reconstitute it:

  • Chemical cross-linking coupled with mass spectrometry:

    • Use isotope-coded cross-linkers like BS3-H12/D12 to identify interaction interfaces

    • Analyze cross-linked peptides by high-resolution mass spectrometry

    • Verify cross-links through detection of isotope shifts in MS and MS2 spectra

This approach has successfully identified interactions between PetP and subunit IV (PetD) in Thermosynechococcus elongatus, revealing that PetP is located on the cytoplasmic side of the b6f complex .

  • Co-immunoprecipitation with tagged variants:

    • Express Cytochrome b6 with affinity tags (His, TAP, or Strep·Tag)

    • Pull down protein complexes under native conditions

    • Identify interacting partners by immunoblotting or mass spectrometry

  • Blue-native PAGE (BN-PAGE):

    • Separate intact protein complexes under non-denaturing conditions

    • Identify complex composition through second-dimension SDS-PAGE

    • Compare migration patterns of wild-type and mutant complexes

BN-PAGE analysis has been useful in comparing the stability and composition of wild-type and mutant b6f complexes, showing differences in the relative abundance of monomeric versus dimeric forms .

How does the absence of specific subunits affect the assembly and stability of the Cytochrome b6f complex?

The impact of subunit deletion on complex stability can provide valuable insights into assembly pathways and functional interdependencies. Studies on the PetP subunit in cyanobacteria offer a relevant example:

In Thermosynechococcus elongatus, deletion of the PetP subunit results in:

These findings suggest that PetP plays a crucial role in stabilizing the dimeric form of the complex and maintaining its functional integrity. For P. akinetum Cytochrome b6, similar subunit deletion studies could reveal specific requirements for complex assembly and stability in this organism.

What are the most reliable methods for measuring electron transport activity of recombinant P. akinetum Cytochrome b6?

Assessing the functional activity of recombinant Cytochrome b6 requires methods that closely mimic its native electron transport role:

Assay TypePrincipleAdvantagesLimitations
Cytochrome c reductionMonitors reduction of cytochrome c by the b6f complexSimple spectrophotometric detectionMay not reflect in vivo rates
Oxygen consumptionMeasures O2 uptake in reconstituted systemsDirectly correlates with electron flowRequires oxygen electrode setup
Flash-induced absorption spectroscopyTracks redox changes after light activationTime-resolved kinetic informationComplex data interpretation
Artificial electron donor/acceptor assaysUses duroquinol or other donors to drive activityIsolates b6f function from other complexesMay not reflect physiological conditions

For the most physiologically relevant measurements, reconstituted proteoliposomes containing purified recombinant Cytochrome b6 (or the complete b6f complex) can be used to measure electron transport rates between artificial donors and acceptors. This approach allows for controlled assessment of protein activity in a membrane-like environment.

How do mutations in Cytochrome b6 affect linear versus cyclic electron transport?

The differential impact of mutations on linear versus cyclic electron transport pathways can provide insights into the specific role of Cytochrome b6 in each process:

Studies with the ΔpetP mutant in Thermosynechococcus elongatus have shown that the absence of the PetP subunit causes:

  • Strong decrease in linear electron transport

  • Minimal impact on cyclic electron transport via photosystem I and cytochrome b6f

This suggests the existence of distinct pools of cytochrome b6f complexes with different functions that might be correlated with supercomplex formation . Similar functional differentiation might exist in P. akinetum, potentially influenced by specific regions or residues in Cytochrome b6.

When designing experimental approaches to investigate this phenomenon in P. akinetum, researchers should:

  • Create targeted mutations in conserved regions of Cytochrome b6

  • Measure linear electron transport using P700+ reduction kinetics

  • Assess cyclic electron transport through specific spectroscopic techniques

  • Compare results with whole-cell photosynthetic parameters using oxygen evolution and fluorescence measurements

Why might recombinant P. akinetum Cytochrome b6 show lower activity than the native protein?

Several factors can contribute to reduced activity of recombinant Cytochrome b6:

  • Improper cofactor incorporation:

    • Insufficient heme availability during expression

    • Improper coordination of heme groups due to protein misfolding

    • Incorrect redox state of incorporated hemes

  • Protein modification issues:

    • Absence of essential post-translational modifications

    • Incorrect processing of leader sequences or internal segments

    • Presence of purification tags that interfere with activity

  • Structural integrity problems:

    • Loss of critical lipids during purification

    • Detergent-induced conformational changes

    • Destabilization of protein-protein interfaces in the complex

  • Experimental artifacts:

    • Oxidative damage during purification

    • Non-physiological buffer conditions

    • Aggregation or oligomerization state differences

To address these issues, researchers can implement:

  • Co-expression of heme biosynthesis enzymes

  • Addition of specific lipids during purification and storage

  • Use of native or cleavable tags positioned away from functional regions

  • Inclusion of appropriate reducing agents throughout preparation

How can aggregation of recombinant Cytochrome b6 during purification be prevented?

Membrane proteins like Cytochrome b6 are prone to aggregation during purification. The following strategies can minimize this problem:

  • Optimization of solubilization conditions:

    • Screen multiple detergents (DDM, digitonin, LMNG) at various concentrations

    • Include specific lipids (SQDG, MGDG) to stabilize native conformation

    • Maintain specific ionic strength (typically 100-300 mM NaCl)

  • Temperature management:

    • Perform all purification steps at 4°C

    • Avoid freeze-thaw cycles

    • Control temperature during concentration steps

  • Buffer additives:

    • Include 10-20% glycerol as a stabilizing agent

    • Add specific amphipathic polymers like amphipol A8-35

    • Maintain reducing environment with DTT or TCEP

  • Purification strategy modifications:

    • Implement size exclusion chromatography as a final polishing step

    • Use on-column detergent exchange to transition to milder conditions

    • Consider purifying the entire b6f complex rather than individual components

Monitoring protein homogeneity through dynamic light scattering or analytical ultracentrifugation throughout the purification process can help identify conditions that promote aggregation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.