Recombinant Pseudendoclonium akinetum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudendoclonium akinetum Photosystem I Assembly Protein Ycf4 (ycf4)

Recombinant Pseudendoclonium akinetum Photosystem I assembly protein Ycf4 (ycf4) is a protein crucial for the assembly of Photosystem I (PSI) in photosynthetic organisms . Ycf4 is a highly conserved protein found in organisms ranging from cyanobacteria to higher plants . It is encoded by the chloroplast genome in eukaryotes .

Structure and Characteristics of Ycf4

Ycf4 is a 22-kD protein with two putative transmembrane domains . It is localized to the thylakoid membrane as part of a large complex .

Function in Photosystem I (PSI) Assembly

Ycf4 is essential for the accumulation of PSI in Chlamydomonas reinhardtii . The Ycf4 protein functions as an assembly factor for PSI . Research indicates that Ycf4 is part of a large complex that interacts with other biomolecules .

Ycf4 in Different Organisms

  • Chlamydomonas reinhardtii: In the green alga C. reinhardtii, Ycf4 is essential for PSI complex assembly .

  • Arabidopsis thaliana: In Arabidopsis thaliana, Ycf4 is not essential, but it plays a regulatory role in cyanobacteria .

  • Higher Plants: While Ycf4 is essential in Chlamydomonas, studies on tobacco (Nicotiana tabacum) have shown that Ycf4 is not essential for photosynthesis in higher plants, although mutants lacking Ycf4 show a deficiency in PSI accumulation .

5.1. Purification and Composition of Ycf4 Complex

To investigate the biochemical properties of the large complex containing Ycf4, researchers have purified a Ycf4-containing complex and identified its protein components using N-terminal amino acid sequencing, immunoblot, and mass spectrometry analyses . Electron microscopy reveals that the Ycf4-containing complex is larger than 1500 kD and contains a retinal-binding protein, COP2, and several PSI polypeptides, which appear to be assembled into an intermediate assembly subcomplex .

5.2. Role of COP2

The decrease in COP2 to 10% of wild-type levels by RNA interference increased the salt sensitivity of the Ycf4 complex stability but did not affect the accumulation of PSI, suggesting that COP2 is not essential for PSI assembly .

5.3. TAP-Tagged Ycf4

Experiments involving TAP-tagged Ycf4 in C. reinhardtii show that the function and structure of Ycf4 are not significantly affected by the fusion of the TAP-tag at the C terminus of Ycf4 . The PSI complex is assembled like the wild type in the TAP-tagged strain, indicating that neither the fusion of the TAP-tag nor a decrease in Ycf4 accumulation by 75% affected the assembly and stability of the PSI complex .

5.4. Ycf3 and Y3IP1 Interaction

Ycf3 and Ycf4 form modules that mediate PSI assembly . The first module consists of the tetratricopeptide repeat protein Ycf3 and its interacting partner, Y3IP1, and mainly facilitates the assembly of reaction center subunits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
ycf4
Target Protein Sequence
MKPDSIRRYNVIGSRRISNYWWAIIIGSGGLGFLFTGLSSYLQFNLLPIIHAEKIIFFPQ GLVMSFYGILGIFFSLYLGLTILFSVGEGFNEFNKELGIIRIFRWGFPGKNRRIDLSYSI DDVKAIRVELKDGINPKRTIYLCIKGQRQIPLTRVGQPLTLEEIEMQAAELAQFLQKDLL LN
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Ycf4 protein and what is its primary function?

Ycf4 (hypothetical chloroplast open reading frame 4) is an essential thylakoid membrane protein involved in the assembly of photosystem I (PSI). Studies in Chlamydomonas reinhardtii have demonstrated that Ycf4 forms a stable complex larger than 1500 kD that includes PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and the opsin-related protein COP2 . Pulse-chase protein labeling experiments indicate that Ycf4 functions as a scaffold for PSI assembly, binding newly synthesized PSI polypeptides that form a pigment-containing subcomplex . Complete knockout studies in tobacco have confirmed that Ycf4 is essential for photoautotrophic growth, as plants lacking the complete Ycf4 gene cannot survive without an external carbon supply .

How conserved is the Ycf4 gene across different photosynthetic organisms?

The Ycf4 gene shows varying degrees of conservation across photosynthetic organisms. While it is present in most photosynthetic eukaryotes, some species have lost this gene through evolutionary processes. For example, some species of Pteridophyta and Gymnosperm have experienced loss events of ycf15, another chloroplast gene . The ycf4 gene location within the chloroplast genome also varies, with significant rearrangements observed in some plant families. In the tribe Jasmineae (Jasminum and Menodora), the ycf4-psaI region has been relocated due to multiple overlapping inversions . This variability in gene presence and location makes ycf4 potentially useful as a marker for distinguishing between certain plant species or lineages.

What happens when the Ycf4 gene is completely deleted?

Complete deletion of the Ycf4 gene has severe consequences for photosynthetic organisms. In tobacco, plants with the complete Ycf4 sequence removed (Δycf4) were unable to survive photoautotrophically and required an external carbon supply for growth . These plants displayed a light green phenotype initially, with leaves becoming pale yellow as the plants aged. Transmission electron microscopy revealed structural abnormalities in the chloroplasts of Δycf4 mutants, including changes in shape, size, and grana stacking compared to wild-type plants . Transcriptome analysis showed that while PSI and PSII gene expression remained unchanged, the expression of rbcL, LHC, and ATP Synthase genes decreased, suggesting that Ycf4 has functions beyond just assembling the photosynthetic complex .

What domains or motifs are important for Ycf4 function?

The C-terminal region of Ycf4 appears particularly important for its function. In-silico protein-protein interaction studies comparing the full-length Ycf4 with truncated versions (93 amino acids from the N-terminus and 91 amino acids from the C-terminus) revealed that the C-terminal portion (91 amino acids) is critical for interactions with other chloroplast proteins . This finding aligns with previous research showing that incomplete knockout of Ycf4 (removing just 93 of 184 amino acids from the N-terminus) resulted in a less severe phenotype than complete gene deletion . Molecular docking studies of full-length and truncated versions of Ycf4 with photosynthesis-responsive proteins provide further evidence for the importance of specific protein domains in facilitating proper PSI assembly .

What other proteins interact with Ycf4 and how do these interactions contribute to PSI assembly?

Ycf4 has been shown to interact with various proteins involved in photosynthesis. In Chlamydomonas reinhardtii, Ycf4 interacts intimately with COP2, an opsin-related protein, as demonstrated by their co-purification through sucrose gradient ultracentrifugation and ion exchange column chromatography . The Ycf4-containing complex also includes the PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . While COP2 appears to contribute to the stability of the Ycf4 complex (particularly under salt stress), it is not essential for PSI assembly, as reducing COP2 levels to 10% of wild-type did not affect PSI accumulation . The specific interactions between Ycf4 and PSI components likely create a spatial arrangement that facilitates the proper assembly of the photosynthetic apparatus.

What are the recommended approaches for expressing and purifying recombinant Ycf4 protein?

For expressing and purifying recombinant Ycf4, a tandem affinity purification (TAP) tag approach has proven effective. In studies with Chlamydomonas reinhardtii, researchers used TAP-tagged Ycf4 to purify a stable Ycf4-containing complex . This technique involves:

  • Creating a construct with the Ycf4 gene fused to a TAP tag

  • Expressing this construct in an appropriate expression system

  • Performing initial purification using the first affinity tag

  • Cleaving the linker between tags using a specific protease

  • Conducting second-stage purification using the second affinity tag

This two-step purification process helps isolate Ycf4-containing complexes with high purity. For subsequent complex characterization, sucrose gradient ultracentrifugation followed by ion exchange column chromatography has been successful in separating Ycf4-containing complexes from other cellular components .

What methods are effective for studying protein-protein interactions involving Ycf4?

Several complementary approaches can be used to study Ycf4 protein interactions:

  • Mass Spectrometry (MS): Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been used to identify proteins associated with Ycf4 in purified complexes .

  • Immunoblotting: Western blot analysis with antibodies against potential interaction partners can confirm the presence of specific proteins in Ycf4 complexes .

  • Co-purification Studies: Sucrose gradient ultracentrifugation followed by ion exchange chromatography can demonstrate intimate associations between proteins, as shown for Ycf4 and COP2 .

  • Pulse-chase Protein Labeling: This technique can reveal the dynamic association of newly synthesized proteins with the Ycf4 complex, providing insights into assembly processes .

  • In-silico Molecular Docking: Computational approaches using tools like ClusPro 2.0 can predict interactions between Ycf4 and other photosynthesis-related proteins based on their structures .

  • RNA Interference (RNAi): Reducing the expression of potential interaction partners (as done with COP2) can help determine their functional significance in the Ycf4 complex .

How can researchers effectively generate and verify Ycf4 knockout mutants?

Based on successful approaches in tobacco, the following methodology can be used to generate and verify Ycf4 knockout mutants:

  • Gene Replacement Strategy: Replace the complete Ycf4 gene with a selectable marker gene (e.g., aadA for spectinomycin resistance) through homologous recombination events .

  • Verification Methods:

    • PCR analysis using primers flanking the targeted region

    • Southern blot analysis to confirm proper integration and homoplasmy

    • Phenotypic assessment for characteristic changes (light green/yellow leaves)

    • Transmission electron microscopy to examine chloroplast structural changes

  • Homoplasmy Confirmation: Since chloroplasts contain multiple genome copies, ensuring complete replacement in all copies (homoplasmy) is crucial and may require multiple rounds of selection .

  • Functional Complementation: To confirm that observed phenotypes result from Ycf4 deletion, researchers should attempt to restore the wild-type phenotype by reintroducing the Ycf4 gene .

How should researchers analyze transcriptomic data from Ycf4 mutants?

When analyzing transcriptomic data from Ycf4 mutants, researchers should:

  • Compare Multiple Gene Groups: Analyze changes in different functional categories of genes, including PSI, PSII, ribosomal genes, and carbon fixation components (rbcL, LHC, ATP Synthase) .

  • Distinguish Direct vs. Indirect Effects: The Δycf4 tobacco mutant showed unchanged PSI and PSII gene expression but decreased expression of rbcL, LHC, and ATP Synthase genes, suggesting both direct and indirect effects of Ycf4 deletion .

  • Correlate with Phenotypic Data: Connect transcriptional changes with observed phenotypes, such as chloroplast structural abnormalities or photosynthetic capacity .

  • Consider Temporal Dynamics: Gene expression may change as mutant plants develop, as seen in tobacco Δycf4 plants whose leaves became progressively more yellow with age .

  • Pathway Enrichment Analysis: Identify which biological pathways are most affected by Ycf4 deletion to understand the broader impact on cellular function.

What are the key considerations when interpreting protein-protein interaction data for Ycf4?

When interpreting protein-protein interaction data for Ycf4, researchers should consider:

  • Interaction Strength vs. Functional Significance: Strong interactions may not always indicate functional importance, as demonstrated by COP2, which interacts intimately with Ycf4 but is not essential for PSI assembly .

  • Direct vs. Indirect Interactions: Distinguish between direct physical interactions and associations mediated by other components within larger complexes.

  • Domain-Specific Interactions: Consider which domains of Ycf4 are responsible for specific interactions, as the C-terminal portion appears particularly important for protein-protein interactions .

  • Physiological Context: Interactions observed in vitro or through computational prediction should be validated in physiologically relevant conditions.

  • Cross-Species Comparisons: While interactions observed in one species (e.g., Chlamydomonas or tobacco) provide valuable insights, interaction patterns may vary in Pseudendoclonium akinetum due to evolutionary divergence.

How can researchers reconcile contradictory findings about Ycf4 essentiality in different studies?

Contradictory findings regarding Ycf4 essentiality can be reconciled by considering:

  • Extent of Gene Deletion: Some studies reported Ycf4 as non-essential based on incomplete knockout (removing only 93 of 184 amino acids from the N-terminus), while complete deletion demonstrated it is essential for photoautotrophic growth .

  • Functional Domains: The C-terminus (91 amino acids) of Ycf4 appears crucial for interactions with other chloroplast proteins, possibly explaining why partial deletions preserving this region have less severe effects .

  • Species-Specific Differences: The necessity of Ycf4 may vary between photosynthetic organisms due to evolutionary adaptations or the presence of compensatory mechanisms.

  • Growth Conditions: The essentiality of Ycf4 may be conditional, with mutants showing more severe phenotypes under specific environmental conditions or developmental stages.

  • Quantitative vs. Qualitative Assessment: Some studies may report qualitative viability while missing quantitative defects in photosynthetic efficiency or fitness.

How does Ycf4 contribute to transcriptional regulation beyond its role in PSI assembly?

Recent evidence suggests Ycf4 has functions beyond PSI assembly, potentially including transcriptional regulation:

  • Differential Gene Expression: In tobacco Δycf4 plants, while PSI and PSII gene expression remained unchanged, rbcL, LHC, and ATP Synthase gene expression decreased, suggesting Ycf4 may influence the expression of specific chloroplast genes .

  • Protein-Protein Interactions: The C-terminal domain of Ycf4 interacts with various chloroplast proteins, potentially forming complexes that could influence transcriptional processes .

  • Potential Mechanisms: Ycf4 might affect transcription by:

    • Interacting with transcription factors or RNA polymerase components

    • Influencing chloroplast RNA processing or stability

    • Modulating retrograde signaling between chloroplast and nucleus

    • Affecting the spatial organization of chloroplast DNA or transcriptional machinery

Further research is needed to elucidate the precise mechanisms by which Ycf4 influences gene expression patterns beyond its established role in PSI assembly.

What role does Ycf4 play in the evolutionary dynamics of chloroplast genomes?

Ycf4 contributes to chloroplast genome evolutionary dynamics in several ways:

  • Genomic Rearrangements: The ycf4-psaI region has been relocated in some plant species due to overlapping inversions. In Jasminum and Menodora (Oleaceae), this region was relocated by inversions of varying sizes (21,169 and 18,414 bp in Jasminum; 14 and 59 kb in Menodora) .

  • Marker for Evolutionary Events: The presence, absence, or location of ycf4 can serve as a marker for evolutionary events in chloroplast genomes. Just as ycf15 has been used to distinguish between plant genera (e.g., Colchicum from Gloriosa) , ycf4 may provide similar phylogenetic insights.

  • Selection Pressure: The conservation of ycf4 across many photosynthetic organisms despite genomic rearrangements suggests strong selection pressure maintaining its function, highlighting its evolutionary importance.

  • Gene Loss Events: While some chloroplast genes like ycf15 have been lost in certain lineages , the retention of ycf4 in most photosynthetic organisms underscores its fundamental role in photosynthesis.

How can comparative analysis of Ycf4 across species inform structure-function relationships?

Comparative analysis of Ycf4 across species provides valuable insights into structure-function relationships:

  • Conserved Domains: Identifying regions conserved across evolutionary diverse organisms can pinpoint functionally critical domains. The C-terminal region appears particularly important for Ycf4 function based on in-silico protein-protein interaction studies .

  • Species-Specific Adaptations: Variations in Ycf4 sequence or structure between species may reflect adaptations to different photosynthetic requirements or environmental conditions.

  • Correlation with Complex Composition: Differences in Ycf4 structure may correlate with variations in PSI complex composition or assembly processes across species.

  • Experimental Approach: Researchers can use domain swapping between Ycf4 proteins from different species, followed by functional complementation assays, to identify which regions are responsible for species-specific functions.

  • Molecular Docking Predictions: Computational approaches comparing interaction patterns of Ycf4 from different species with their respective partner proteins can predict how structural differences influence functional interactions .

What are the major challenges in isolating pure and active recombinant Ycf4 protein?

Isolating pure and active recombinant Ycf4 presents several challenges:

  • Membrane Protein Solubility: As a thylakoid membrane protein, Ycf4 has hydrophobic regions that can cause aggregation during extraction and purification.

    • Solution: Use appropriate detergents (e.g., n-dodecyl-β-D-maltoside) at optimal concentrations to solubilize membrane proteins while maintaining native structure.

  • Complex Stability: The Ycf4-containing complex may dissociate during purification, particularly under certain salt conditions .

    • Solution: Optimize buffer composition based on salt sensitivity data, as demonstrated in studies showing COP2's role in complex stability under salt stress .

  • Maintaining Associated Proteins: Preserving physiologically relevant protein interactions during purification is challenging.

    • Solution: Use gentle purification methods like tandem affinity purification, which has successfully isolated intact Ycf4-containing complexes .

  • Expression System Compatibility: Choosing an appropriate expression system for a chloroplast membrane protein.

    • Solution: Consider chloroplast-based expression systems or those optimized for membrane proteins, with codon optimization if necessary.

How can researchers differentiate between direct and indirect effects of Ycf4 deletion?

Differentiating between direct and indirect effects of Ycf4 deletion requires multiple approaches:

  • Temporal Analysis: Monitor changes over time following Ycf4 depletion to distinguish primary from secondary effects.

    • Implementation: Use inducible knockdown systems or time-course analysis after deletion.

  • Partial Complementation: Reintroduce specific domains of Ycf4 to determine which functions they rescue.

    • Implementation: Create constructs expressing only the C-terminal or N-terminal portions of Ycf4 in knockout backgrounds.

  • Interactome Mapping: Identify direct interaction partners of Ycf4 and analyze their function in the absence of Ycf4.

    • Implementation: Combine protein-protein interaction data with functional analysis of interaction partners.

  • Comparative Transcriptomics: Compare gene expression changes in Ycf4 mutants with those in mutants affecting related processes.

    • Implementation: Analyze public datasets from PSI assembly mutants to identify common and unique responses.

  • Biochemical Assays: Perform in vitro assays to test direct biochemical functions of Ycf4.

    • Implementation: Reconstitution experiments with purified components to test direct functional relationships.

What control experiments are essential when studying Ycf4 function in photosynthesis?

Essential control experiments when studying Ycf4 function include:

  • Complementation Controls: Reintroduce the wild-type Ycf4 gene into knockout mutants to verify phenotype rescue.

    • Rationale: Confirms that observed phenotypes are specifically due to Ycf4 absence rather than secondary mutations or off-target effects.

  • Homoplasmy Verification: Confirm complete replacement of all copies of the chloroplast genome.

    • Methods: Southern blot analysis and PCR verification as demonstrated in tobacco Δycf4 studies .

    • Rationale: Incomplete replacement could lead to misleading results due to residual wild-type function.

  • Growth Condition Controls: Test mutant phenotypes under various light intensities, carbon sources, and stress conditions.

    • Rationale: Photosynthetic phenotypes may be condition-dependent, as seen in tobacco Δycf4 plants that required external carbon supply .

  • Specific vs. General Effects: Compare effects on different photosynthetic complexes (PSI, PSII, Cytochrome b6f).

    • Methods: BN-PAGE, spectroscopic measurements, and protein quantification.

    • Rationale: Distinguishes specific PSI assembly defects from general effects on chloroplast protein synthesis or assembly.

  • Protein-Protein Interaction Specificity: Include negative controls when analyzing Ycf4 interactions.

    • Implementation: Test interactions with unrelated chloroplast proteins to confirm specificity of observed associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.