Recombinant Pseudendoclonium akinetum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The recombinant psbA protein corresponds to the D1 subunit of PSII, which binds the plastoquinone QB and is essential for light-driven electron transfer. Key features include:

ParameterSpecification
SourcePseudendoclonium akinetum (a green alga of the Ulvophyceae class)
Protein LengthFull-length (1–344 amino acids)
TagN-terminal His-tag for purification
Expression HostEscherichia coli
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based with 6% trehalose, pH 8.0
Sequence IdentityMatches UniProt ID Q3ZJ60 (100% sequence alignment)

The protein’s sequence includes critical regions for QB binding, such as the Q_B pocket (residues 255–271), which interacts with plastoquinones and herbicides like DCMU .

Role in Photosystem II

The D1 protein (psbA) is central to PSII’s reaction center, forming:

  • Primary electron donor: Part of the P680 chlorophyll special pair .

  • QB-binding pocket: Facilitates electron transfer to plastoquinone .

  • Herbicide target: Binds inhibitors like atrazine and DCMU, disrupting electron flow .

Gene Regulation

In cyanobacteria and algae, psbA genes are often part of multigene families, with transcription regulated by light intensity . For example:

  • High-light conditions: psbAII and psbAIII transcripts increase, while psbAI decreases .

  • Post-transcriptional control: Protein degradation factors modulate mRNA stability under stress .

Expression and Purification

The recombinant psbA protein is produced via bacterial expression systems, with:

  • Host: E. coli (optimized for high-yield expression) .

  • Tag: His-tag enables affinity chromatography purification .

  • Handling: Lyophilized powder reconstituted in deionized water or buffer with glycerol for stability .

Research Applications

ApplicationMethodologyOutcome
Structural StudiesCryo-EM or X-ray crystallography Elucidation of QB-binding interactions and PSII assembly intermediates
Herbicide ScreeningIn vitro binding assays Identification of residues critical for herbicide resistance (e.g., Ser264)
Antibody DevelopmentWestern blotting with anti-PsbA antibodies Detection of D1 degradation products or phosphorylation states

Mutational Studies

Mutations in the QB-binding pocket (e.g., Ser264Ala or Leu275Trp) alter electron transfer efficiency and herbicide resistance:

MutationEffect on QB BindingHerbicide ResistanceSource
Ser264AlaDisrupted H-bond network3,000× DCMU resistance
Leu275TrpAltered hydrophobic interactionsModerate DCMU resistance
Phe255IleReduced electron transfer rateNo resistance change

PSII Assembly Dynamics

  • Psb28 interaction: Blocks QB binding during PSII biogenesis, stabilizing the NH-Fe cofactor with a D2-Glu241 residue .

  • Degradation pathways: D1 turnover is light-dependent, with proteases like FtsH regulating free D1 levels .

Challenges and Future Directions

  • Stability: Recombinant D1 proteins are prone to aggregation; glycerol addition (50% final concentration) improves stability .

  • Functional Reconstitution: Heterologous systems (e.g., E. coli) may lack post-translational modifications critical for PSII activity .

  • Evolutionary Insights: Comparative studies of Pseudendoclonium plastomes reveal conserved psbA gene clusters, aiding phylogenetic analyses .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery times, please consult your local distributors.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Tupiella akineta (Green alga) (Pseudendoclonium akinetum)
Target Names
psbA
Target Protein Sequence
MTAILERREASSLWARFCEWVTSTENRLYVGWFGVIMIPTLLTAVSVFIIAFVAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSNAIGLHFYPIWEAASVDEWLYNGGPYQLIVCHFF LGICCYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESTNAGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSIVDSQGRVLNSWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene and what role does it play in photosynthetic organisms?

The psbA gene encodes the D1 protein, which is a critical component of the Photosystem II (PSII) reaction center. D1 is highly conserved across cyanobacteria and all phyla of plastid-containing photosynthetic eukaryotes, including green algae such as Pseudendoclonium akinetum . The D1 protein plays an essential role in photosynthetic electron transport, particularly in the binding of the QB quinone and facilitating electron transfer. The psbA gene is located in the plastid genome and is fundamental to the function of the photosynthetic apparatus .

Research methodology: Comparative genomic analysis of the psbA sequence across species can be performed using PCR amplification followed by sequencing. For functional characterization, site-directed mutagenesis and expression of the recombinant protein, coupled with spectroscopic techniques such as EPR (Electron Paramagnetic Resonance), provides insights into the protein's role.

How can researchers successfully express recombinant Photosystem II proteins from algal sources?

Expressing functional recombinant Photosystem II proteins requires careful consideration of the expression system and conditions. For algal PSII proteins like those from Pseudendoclonium akinetum:

  • Expression system selection:

    • Prokaryotic systems (E. coli) for individual subunits without cofactors

    • Eukaryotic systems (yeast, insect cells) for more complex assemblies

    • Homologous algal systems for fully functional complexes

  • Codon optimization:

    • Adapt the algal gene sequence to the expression host's preferred codon usage

    • Consider the potential impact of unusual codon assignments, as some algal species show noncanonical genetic codes in their plastids

  • Purification strategy:

    • Incorporate affinity tags (His-tag, Strep-tag) for simplified purification

    • Design tag placement to minimize interference with protein function

    • Consider mild detergents for membrane protein solubilization

The expression of functional QB-binding D1 protein often requires co-expression with other PSII subunits to achieve proper folding and assembly.

What techniques are available for assessing the functional integrity of recombinant psbA proteins?

Multiple complementary techniques can verify the functional integrity of recombinant psbA (D1) proteins:

  • Spectroscopic methods:

    • Oxygen evolution measurements using oxygen electrodes to assess water-splitting activity

    • Chlorophyll fluorescence analysis to evaluate PSII quantum efficiency

    • Thermoluminescence to measure charge recombination events between QB- and S2/S3 states

  • Electron transfer kinetics:

    • Flash-induced oxygen evolution patterns to assess S-state transitions

    • Time-resolved spectroscopy to measure electron transfer rates

    • EPR spectroscopy to detect formation of QB- semiquinone

  • Structural verification:

    • Western blotting with D1-specific antibodies to confirm expression and stability

    • Analysis of characteristic D1 degradation products (e.g., 23 kDa fragments) as seen in photoinhibition studies

The flash-induced oxygen yield pattern is particularly informative, as demonstrated in studies of psbA mutants where altered patterns reveal specific changes in QB function .

How do specific mutations in the psbA gene affect the redox properties of the QB site?

Mutations in the psbA gene, particularly those affecting amino acids near or within the QB-binding pocket, can significantly alter the redox properties of the QB site. Based on studies of psbA mutants:

  • Mutations near the QB-binding pocket can affect:

    • The midpoint potential of the QB/QB- redox couple

    • The stability of the semiquinone intermediate (QB-)

    • The kinetics of electron transfer from QA- to QB

    • The binding affinity of plastoquinone/plastoquinol

For example, in studies with Phaeodactylum tricornutum, mutations in the D1 protein led to altered redox states of QB, with consequent effects on PSII function . The S264A mutation showed significantly elevated QB reduction, indicating altered redox properties .

Research methodology: Engineered mutations can be introduced through site-directed mutagenesis, followed by spectroelectrochemical titrations to determine midpoint potentials. EPR spectroscopy is especially valuable for measuring the QB/QB- redox couple, as demonstrated in Thermosynechococcus elongatus where E(QB/QB-) was determined to be approximately +90 mV .

E(QB/QB)+90 mVE(Q_B/Q_B^{- -}) \approx +90 \text{ mV} E(QB/QBH2)+40 mVE(Q_B^{- -}/Q_BH_2) \approx +40 \text{ mV}

These measured potentials reveal that the protein environment significantly tunes the thermodynamics of quinone redox chemistry to optimize electron transfer function.

What experimental approaches can quantify the energetics of electron transfer in recombinant Photosystem II proteins?

Quantifying electron transfer energetics in recombinant PSII requires sophisticated biophysical techniques:

  • EPR spectroscopy:

    • Direct measurement of semiquinone formation and stability

    • Determination of redox midpoint potentials through redox titrations

    • Investigation of the protein environment effects on QB properties

  • Thermoluminescence:

    • Measurement of characteristic emission bands (Q-band at ~7°C and B-band at ~22°C)

    • Correlation of band temperatures with recombination states (S2QB- and S2/3QB-)

    • Assessment of the redox potential changes in QB and QB-

  • Flash-induced spectroscopy:

    • Time-resolved measurements of electron transfer rates

    • Determination of activation energies through temperature dependence studies

    • Investigation of kinetic isotope effects using deuterated systems

A comprehensive approach combines these techniques with theoretical modeling. For instance, using thermoluminescence emission profiles from dark-adapted cells can reveal characteristic emission bands that reflect the recombination states of the PSII reaction center and the redox potential of QB .

How does the protein environment tune the redox properties of the QB site to optimize photosynthetic electron transport?

The protein environment surrounding the QB site plays a crucial role in tuning its redox properties to ensure efficient photosynthetic electron transport:

  • Hydrogen bonding network:

    • Specific hydrogen bonds between the quinone and protein residues modulate redox potential

    • The positioning of water molecules creates a defined electrostatic environment

  • Hydrophobicity of the binding pocket:

    • The QB site resides between the DE helix and transmembrane E helix of the D1 protein

    • The balance between hydrophobic and hydrophilic interactions affects quinone binding energy

  • Protein dynamics:

    • Conformational changes facilitate protonation of the semiquinone

    • Structural rearrangements modulate quinone/quinol exchange

Research indicates that the protein environment optimizes several thermodynamic parameters:

ΔE234 meV\Delta E \approx 234 \text{ meV}

This represents the driving force for electron transfer from QA- to QB based on the difference between E(QB/QB-) and E(QA/QA-) .

The QB site is specifically tuned to stabilize the semiquinone state thermodynamically, which minimizes back-reactions and prevents electrons from leaking onto oxygen, thereby protecting the photosynthetic apparatus from oxidative damage .

What methodologies can be employed to study differences in psbA codon usage and potential reassignments across algal species?

Investigating psbA codon usage patterns and reassignments requires specialized comparative genomic approaches:

  • Comparative sequence analysis:

    • Alignment of psbA sequences from diverse algal lineages

    • Identification of conserved and variable regions

    • Statistical analysis of codon usage patterns

  • Translational verification:

    • Comparison of gene sequences with experimentally determined protein sequences

    • Mass spectrometry validation of protein products

    • Ribosome profiling to identify actual translated codons

  • Experimental verification of codon reassignment:

    • Heterologous expression systems with controlled tRNA availability

    • Site-directed mutagenesis to introduce specific codons

    • In vitro translation systems with defined tRNA components

This methodological approach led to the unexpected discovery that in Chloroparvula (a chloropicophycean alga), the AUA codon was reassigned from isoleucine to methionine in plastids, despite the disappearance of trnI(cau) from the plastome . This noncanonical genetic code had not been previously identified in plastids and represents an important consideration when expressing recombinant algal proteins.

How should researchers design experiments to study the impact of environmental factors on psbA gene expression and D1 protein turnover?

Designing robust experiments to study environmental effects on psbA expression requires:

  • Controlled environmental variables:

    • Light intensity manipulation (50-2000 μmol photons·m-2·s-1)

    • Spectral quality variation (blue, red, white light)

    • Temperature control (typical range: 15-35°C)

    • Nutrient availability (particularly iron and nitrogen)

  • Experimental approach:

    • Split-plot design with factorial treatment combinations

    • Time-course measurements at physiologically relevant intervals

    • Multiple biological replicates (minimum n=3)

  • Measurement protocols:

    • Quantitative RT-PCR for psbA transcript levels

    • Western blot analysis for D1 protein content and turnover

    • Pulse-chase experiments with isotope labeling

    • Chlorophyll fluorescence for functional assessment

A Bayesian experimental design approach can be particularly valuable, allowing for optimization of sampling times and conditions based on prior information . This adaptative design strategy maximizes information yield, especially for non-linear responses typical in photosynthetic systems under stress.

The D1 protein degradation products (particularly the 23 kDa fragment and cross-link products of ~83 kDa) can serve as sensitive markers for stress-induced photoinhibition .

What statistical approaches are most appropriate for analyzing data from psbA mutation studies?

Analyzing psbA mutation studies requires sophisticated statistical approaches:

  • For comparing mutant and wild-type phenotypes:

    • Mixed-effects models to account for repeated measurements

    • ANOVA with post-hoc tests (Tukey's HSD) for multiple comparisons

    • Non-parametric alternatives when normality assumptions are violated

  • For dose-response relationships (e.g., light intensity effects):

    • Non-linear regression models

    • EC50 determination for physiological responses

    • Principal component analysis for multivariate response variables

  • For electron transfer kinetics data:

    • Exponential decay fitting with comparison of rate constants

    • Arrhenius analysis for temperature-dependent processes

    • Bayesian parameter estimation for complex kinetic models

Data visualization should include:

  • Box plots showing distribution of measurements

  • Time-course plots with error bars (standard deviation or standard error)

  • Correlation matrices for multiple parameters

When analyzing oxygen evolution patterns or thermoluminescence data from multiple mutants, hierarchical clustering can help identify functional groupings of mutations with similar phenotypic effects .

How can researchers resolve contradictory results between different analytical methods when studying recombinant psbA proteins?

When faced with contradictory results from different analytical methods:

  • Systematic method comparison:

    • Identify the fundamental principles behind each method

    • Evaluate assumptions inherent in each technique

    • Assess potential artifacts specific to each approach

  • Sample-specific considerations:

    • Examine protein purity and integrity across preparations

    • Consider post-translational modifications

    • Evaluate protein conformational states in different experimental conditions

  • Reconciliation strategies:

    • Develop unifying models that explain apparent contradictions

    • Use orthogonal methods to validate key findings

    • Apply integrated data analysis approaches that combine multiple data types

Example reconciliation: If oxygen evolution measurements suggest normal QB function but thermoluminescence shows altered QB- stability, consider that:

  • Different aspects of QB function are being measured

  • The techniques operate at different time scales

  • The experimental conditions (particularly temperature) differ

The study of psbA mutants often reveals that seemingly contradictory results actually reflect the multifaceted nature of the D1 protein's role in photosynthesis .

What are the key considerations when interpreting thermodynamic data for the QB site across different species?

Interpreting QB site thermodynamic data across species requires careful consideration of:

  • Evolutionary context:

    • Phylogenetic relationships between studied organisms

    • Environmental adaptations that might drive selection

    • Structural conservation of the QB binding pocket (~90-93% similarity between diatoms, red lineage, green lineage, and cyanobacteria)

  • Methodological factors:

    • Standardization of measurement techniques

    • Reference electrode calibration for potential measurements

    • Temperature correction for thermodynamic parameters

  • Biophysical considerations:

    • Membrane lipid environment effects on redox potentials

    • pH dependency of redox couples involving protonation

    • Conformational differences affecting quinone binding

When comparing thermodynamic data, it's essential to note that the protein tunes the QB redox chemistry to optimize function across diverse environments. For example, in Thermosynechococcus elongatus, the difference between E(QB/QBH2) (~65 mV) and E(PQ/PQH2) (~117 mV) creates a ~50 meV driving force for QBH2 release into the plastoquinone pool .

The resulting thermodynamic landscape establishes that:

  • Semiquinone (QB-) is stabilized thermodynamically

  • PQ binds ~50× more tightly than PQH2

  • Electron transfer from QA- to QB has a substantial driving force (~234 meV)

This optimization appears to be conserved across diverse photosynthetic organisms despite variations in their ecological niches.

What strategies can overcome challenges in expressing functional recombinant D1 proteins with an intact QB binding site?

Expressing functional recombinant D1 proteins with intact QB binding sites presents several challenges that can be addressed through:

  • Expression system optimization:

    • Testing cyanobacterial host systems (e.g., Synechocystis sp. PCC 6803)

    • Utilizing algal chloroplast transformation when available

    • Considering cell-free expression systems with supplied lipids/cofactors

  • Protein stabilization approaches:

    • Co-expression with other PSII subunits (particularly D2)

    • Incorporation of specific lipids required for quinone binding

    • Utilizing fusion protein constructs with stabilizing partners

  • Functional reconstitution:

    • Supplying synthetic quinones during protein folding

    • Step-wise assembly of subcomplexes

    • In vitro reconstitution of membrane environments

Successful expression can be verified through Western blot analysis using D1-specific antibodies, similar to those used to detect D1 in wild-type and psbA mutant cells of Phaeodactylum tricornutum . The detection of characteristic D1 cross-link products (~83 kDa) and degradation products (~23 kDa) can serve as indicators of proper D1 folding and turnover mechanisms.

How can researchers accurately measure the redox potential of the QB/QB- couple in recombinant Photosystem II complexes?

Accurately measuring the QB/QB- redox potential requires specialized techniques:

  • Spectroelectrochemical approaches:

    • Direct electrochemistry with mediators

    • Optical detection of QB- formation

    • Potentiometric titrations with redox mediators

  • EPR spectroscopy:

    • Detection of the QB- semiquinone signal

    • Correlation of signal intensity with applied potential

    • Determination of midpoint potentials through Nernst equation analysis

  • Technical considerations:

    • Anaerobic conditions to prevent oxidation

    • Temperature control (typically 5-25°C)

    • Buffer composition optimization (pH, ionic strength)

    • Calibration with known redox standards

A methodological workflow would include:

  • Preparation of purified PSII complexes with intact QB

  • Addition of appropriate redox mediators

  • Equilibration at controlled potentials

  • Detection of QB- by EPR or optical spectroscopy

  • Fitting of the experimental data to the Nernst equation

Using such approaches, researchers determined that E(QB/QB-) ≈ +90 mV and E(QB-/QBH2) ≈ +40 mV in Thermosynechococcus elongatus . Similar methodologies could be applied to recombinant Pseudendoclonium akinetum PSII complexes.

What are promising approaches for engineering the psbA gene to enhance photosynthetic efficiency or stress tolerance?

Engineering the psbA gene offers opportunities to enhance photosynthetic performance:

  • Targeted modification strategies:

    • QB pocket engineering to optimize electron transfer kinetics

    • D1 repair mechanism enhancement to improve recovery from photodamage

    • Alteration of redox potential tuning to minimize back-reactions

  • Specific engineering targets:

    • Residues near the QB binding site that affect quinone affinity

    • Amino acids involved in the water-splitting mechanism

    • Positions that influence D1 turnover during repair cycles

  • Advanced approaches:

    • Directed evolution with selection for desired photosynthetic traits

    • Computational design based on quantum mechanical models

    • Integration of non-canonical amino acids at critical positions

Studies of natural psbA mutants provide valuable insights for engineering. For example, the V219I mutation in Phaeodactylum tricornutum showed only slight effects on photosynthetic efficiency, while the L275W mutation significantly altered QB function and D1 turnover . These observations highlight positions that could be targeted for specific functional modifications.

How might comparative studies of the psbA gene across diverse algal species inform our understanding of photosynthetic evolution?

Comparative psbA studies across algal lineages can provide unique evolutionary insights:

  • Evolutionary rate analysis:

    • Examination of selection pressures on different domains

    • Identification of conserved vs. variable regions

    • Detection of convergent evolution in unrelated lineages

  • Structure-function relationships:

    • Correlation of sequence variations with environmental adaptations

    • Reconstruction of ancestral sequences at key evolutionary nodes

    • Modeling of functional changes through evolutionary time

  • Unusual evolutionary events:

    • Investigation of genetic code variations (like the AUA codon reassignment from isoleucine to methionine in Chloroparvula)

    • Analysis of horizontal gene transfer events

    • Study of gene duplication and subfunctionalization

The D1 protein is highly conserved across photosynthetic organisms, with the QB-binding pocket showing 97-98% similarity between pennate and centric diatoms, and 90-93% similarity between diatoms and members of the red lineage, green lineage, and cyanobacteria . This extraordinary conservation suggests strong selective pressure on the QB binding pocket throughout evolutionary history, while allowing adaptation in other regions of the protein.

How can systems biology approaches be applied to understand the role of psbA in the broader context of photosynthetic regulation?

Systems biology offers powerful frameworks for understanding psbA in the photosynthetic regulatory network:

  • Multi-omics integration:

    • Correlation of transcriptomics (psbA expression) with proteomics (D1 abundance)

    • Integration of metabolomics to track photosynthetic outputs

    • Phosphoproteomics to identify regulatory post-translational modifications

  • Network modeling approaches:

    • Construction of gene regulatory networks governing psbA expression

    • Flux balance analysis of electron transport through PSII

    • Bayesian network inference to identify causal relationships

  • Temporal dynamics investigation:

    • Time-resolved -omics to capture regulatory dynamics

    • Identification of feedback loops between photosynthetic performance and gene expression

    • Modeling of D1 protein turnover in response to environmental changes

These approaches can reveal how the psbA gene and D1 protein are integrated into cellular responses to changing light conditions. For example, mutants with alterations in the QB site show compensatory responses, such as increased PSII reaction center concentration when electron transport rates are reduced .

What interdisciplinary approaches combining structural biology, biophysics, and genomics would advance our understanding of QB site function?

Advancing QB site research requires interdisciplinary integration:

  • Structural biology contributions:

    • High-resolution cryo-EM of PSII complexes in different redox states

    • Time-resolved crystallography to capture QB site dynamics

    • NMR studies of quinone binding and mobility

  • Biophysical investigations:

    • Ultra-fast spectroscopy to track electron transfer events

    • Single-molecule techniques to observe heterogeneity

    • Advanced EPR methods (ENDOR, HYSCORE) to probe the QB environment

  • Genomic/computational approaches:

    • Comparative genomics across diverse photosynthetic lineages

    • Molecular dynamics simulations of quinone binding/release

    • Quantum mechanical calculations of electron transfer parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.