Recombinant Pseudoalteromonas atlantica 4-hydroxybenzoate octaprenyltransferase (ubiA)

What is Pseudoalteromonas atlantica 4-hydroxybenzoate octaprenyltransferase (ubiA) and its role in bacterial metabolism?

4-hydroxybenzoate octaprenyltransferase (ubiA) from Pseudoalteromonas atlantica is an enzyme involved in the ubiquinone biosynthesis pathway. The protein is encoded by the ubiA gene (locus name: Patl_0067) and catalyzes the prenylation of 4-hydroxybenzoate, an essential step in the production of ubiquinone, which functions in the electron transport chain. The full-length protein consists of 285 amino acids with a molecular sequence beginning with MSRSVLQGFWLL and ending with AGHYFM . Pseudoalteromonas atlantica is a gram-negative marine bacterium that is commonly found in marine and estuarine environments . The bacterium belongs to the genus Pseudoalteromonas, which was created to accommodate 12 former Alteromonas species .

What are the structural characteristics of P. atlantica ubiA protein?

The P. atlantica ubiA protein (UniProt: Q15ZT9) is characterized by a transmembrane structure typical of prenyltransferases. The complete amino acid sequence reveals multiple hydrophobic regions that likely anchor the protein within the membrane. The protein's functional domains include prenyl binding motifs and catalytic residues essential for the prenyltransferase activity. The protein contains several transmembrane regions as indicated by its hydrophobic amino acid sequence segments such as "LWALMIAAQGLPPWHITGIFMAGVFVMRSAGC" and similar sequences throughout the protein . This membrane association is critical for the protein's function in connecting cytoplasmic metabolism with membrane-bound electron transport components.

What expression systems are suitable for producing recombinant P. atlantica ubiA?

For optimal expression of recombinant P. atlantica ubiA, E. coli-based expression systems are commonly employed, particularly when the goal is to obtain functionally active enzyme. When designing an expression system, researchers should consider the following methodological approaches:

• Vector selection: pET series vectors with T7 promoters are recommended for high-level expression

• Host strain optimization: C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression show better results than standard BL21(DE3)

• Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.3 mM) improve properly folded protein yield

• Membrane fraction isolation: Differential centrifugation followed by detergent solubilization

This methodological approach acknowledges the challenges in expressing membrane-associated proteins like ubiA, which often form inclusion bodies under standard expression conditions. Using these optimized parameters, researchers can typically achieve expression yields of 2-5 mg/L of culture.

How does P. atlantica ubiA compare functionally with homologous enzymes from other bacterial species?

Comparative analysis of P. atlantica ubiA with homologous enzymes from other species reveals both conserved features and species-specific adaptations. While the core catalytic mechanism remains conserved, variations in substrate specificity and reaction kinetics have been observed across different bacterial species.

The structural comparison between P. atlantica ubiA and similar enzymes from other species reveals interesting patterns of sequence conservation. When examining the conserved regions between β-agarases from Vibrio sp. strain JT0107, P. atlantica strain T6c and Streptomyces coelicolor, specific short regions of homology have been observed . Although these comparisons focus on agarases rather than ubiA directly, they demonstrate the principle of conserved functional domains across related enzymes from marine bacteria.

The sequence EIDXXE, which corresponds to residues 155 to 160 in S. coelicolor β-agarase, represents an example of highly conserved motifs that might have functional significance across different enzymes and species . Similar conserved patterns can be expected in prenyltransferases like ubiA.

What are the optimal conditions for measuring P. atlantica ubiA enzymatic activity in vitro?

Establishing optimal assay conditions for P. atlantica ubiA activity requires careful consideration of multiple parameters. The following methodological approach is recommended based on established protocols for similar prenyltransferases:

• Buffer composition: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 100 mM NaCl

• Substrate concentrations: 50-100 μM 4-hydroxybenzoate, 100-200 μM prenyl diphosphate

• Detergent selection: 0.1% n-dodecyl-β-D-maltoside (DDM) or 0.5% Triton X-100

• Detection methods: HPLC analysis of prenylated products with UV detection at 254 nm

Enzymatic activity measurements should include time-course studies to determine initial reaction rates, and researchers should verify linearity with respect to enzyme concentration. Temperature stability studies indicate that P. atlantica enzymes generally maintain activity at temperatures up to 30°C , suggesting this as an appropriate temperature range for ubiA activity assays.

How does membrane composition affect P. atlantica ubiA activity and stability?

As a membrane-associated enzyme, P. atlantica ubiA function is significantly influenced by lipid environment. Researchers investigating this relationship should consider the following methodological approaches:

• Reconstitution studies using defined lipid compositions (varying phospholipid species and cholesterol content)

• Fluorescence anisotropy measurements to assess protein-lipid interactions

• Activity assays in different detergent and lipid environments

Analysis of P. atlantica native membrane composition reveals a predominance of phosphatidylethanolamine and phosphatidylglycerol, with unique marine adaptations including omega-3 fatty acids. When reconstituting the enzyme in artificial membrane systems, maintaining a similar phospholipid profile improves enzyme stability and activity retention.

The marine origin of P. atlantica suggests that ionic strength may influence protein-membrane interactions. Experimental evidence indicates that P. atlantica enzymes maintain stability in salt concentrations up to 0.5 M NaCl , reflecting adaptation to marine environments.

What purification strategy yields highest purity and activity for recombinant P. atlantica ubiA?

A systematic purification approach for membrane-bound P. atlantica ubiA should follow this methodological framework:

• Membrane fraction isolation: Differential centrifugation of cell lysates (10,000 × g to remove debris, 100,000 × g to collect membranes)

• Detergent solubilization: Screening of detergents (DDM, LDAO, Triton X-100) at various concentrations (0.5-2%)

• Chromatographic separation:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

  • Anion exchange on DEAE-cellulose

  • Size exclusion chromatography as a polishing step

The recommended purification protocol typically yields protein with >90% purity as assessed by SDS-PAGE. The specific activity of purified enzyme preparation can reach 2-5 μmol min⁻¹ mg⁻¹ under optimized conditions.

Table 1: Purification Table for Recombinant P. atlantica ubiA

What are the critical parameters for crystallization of P. atlantica ubiA for structural studies?

Crystallization of membrane proteins like P. atlantica ubiA presents significant challenges that require systematic methodological approaches:

• Detergent screening: Short-chain maltoside detergents (NM, DM, UDM) often provide better crystallization outcomes than DDM

• Lipid cubic phase (LCP) crystallization: Mix protein (10-15 mg/mL) with monoolein at 2:3 ratio

• Additive screening: Include substrate analogs or inhibitors to stabilize protein conformation

• Crystallization conditions:

  • Temperature: 4-20°C

  • pH range: 6.0-8.0

  • Precipitants: PEG 400 (15-35%), ammonium sulfate (1.5-2.5 M)

The inclusion of lipids from marine bacterial membranes as additives has been shown to improve crystal quality in similar membrane proteins. For P. atlantica proteins, maintaining physiologically relevant salt concentrations (0.1-0.5 M NaCl) during crystallization trials often yields better results, reflecting the halophilic nature of the organism.

How can site-directed mutagenesis be used to understand the catalytic mechanism of P. atlantica ubiA?

A systematic mutagenesis approach to elucidate P. atlantica ubiA catalytic mechanism should target:

• Conserved aspartic acid and glutamic acid residues within the EIDXXE motif and similar conserved regions

• Putative substrate binding residues based on homology modeling

• Residues lining the predicted prenyl binding pocket

Methodological approach for mutagenesis studies:

• QuikChange site-directed mutagenesis for single mutations

• Gibson Assembly for multiple mutations or domain swapping

• Functional characterization comparing wild-type and mutant kinetic parameters (kcat, Km)

• Structural analysis of mutants using circular dichroism to confirm folding integrity

Mutations of conserved aspartic and glutamic residues typically result in >90% reduction in catalytic activity while maintaining structural integrity, indicating their direct involvement in catalysis rather than structural roles.

How does P. atlantica ubiA contribute to the organism's adaptation to marine environments?

P. atlantica ubiA likely plays a crucial role in adaptation to marine environments through its contribution to the ubiquinone biosynthesis pathway. The methodological approach to investigating this relationship includes:

• Comparative genomics analysis of ubiA genes across marine and non-marine bacteria

• Growth studies under varying conditions (temperature, salinity, pressure)

• Metabolomic profiling of ubiquinone and related compounds under stress conditions

Pseudoalteromonas species are naturally occurring gram-negative bacteria very common in marine and estuarine environments . In marine bacteria, ubiquinone content and composition often correlate with adaptation to specific ecological niches. P. atlantica produces various extracellular enzymes including agarases , metalloproteases , and serine proteases with algicidal activity , suggesting a complex interaction with its environment.

Environmental stress often triggers increased ubiquinone biosynthesis in marine bacteria, suggesting that ubiA activity may be regulated in response to environmental conditions. This regulatory mechanism could contribute to P. atlantica's ability to thrive in diverse marine habitats.

What is the relationship between P. atlantica ubiA and bacterial virulence or host interaction?

While ubiA itself has not been directly implicated in virulence, P. atlantica produces virulence factors that affect potential hosts, suggesting complex interactions between metabolic and virulence pathways. Methodological approaches to investigate these relationships include:

• Gene knockout studies targeting ubiA and virulence factor genes

• Transcriptomic analysis comparing expression under host-associated vs. free-living conditions

• In vivo infection models using appropriate hosts

P. atlantica has been isolated from shell disease-infected edible crabs (Cancer pagurus), and its extracellular products (ECP) cause rapid mortality when injected into crabs . These crabs exhibit characteristic symptoms including eyestalk retraction, limb paralysis, and lack of antennal sensitivity, suggesting targeting of the nervous system . Histopathological investigations showed large aggregates of hemocytes in the gills and destruction of tubules in the hepatopancreas of affected crabs .

How can structural comparisons of P. atlantica ubiA with homologs inform enzyme engineering efforts?

Structural comparison of P. atlantica ubiA with homologs provides valuable insights for enzyme engineering. Methodological approaches include:

• Homology modeling based on crystal structures of related prenyltransferases

• Molecular dynamics simulations to identify flexible regions and substrate interactions

• Analysis of sequence conservation patterns across taxonomic groups

Engineering efforts might focus on:

• Modifying substrate specificity by targeting residues in the binding pocket

• Enhancing thermostability through introducing stabilizing interactions identified in thermophilic homologs

• Altering product chain length specificity by modifying the prenyl binding channel

Multiple sequence alignments of the amino acid sequences of various glycosyl hydrolases, including β-agarase from Streptomyces coelicolor, have revealed the presence of invariant aspartic and glutamic residues , suggesting catalytic residues that could be targets for engineering in other enzymes including ubiA.

What are common pitfalls in recombinant expression of P. atlantica ubiA and how can they be addressed?

Common challenges in P. atlantica ubiA expression and corresponding methodological solutions include:

• Inclusion body formation:

  • Lower induction temperature (16-18°C)

  • Reduce IPTG concentration (0.1 mM)

  • Co-express with chaperones (GroEL/ES, DnaK/J)

• Low membrane incorporation:

  • Use specialized E. coli strains (C41/C43)

  • Co-express with membrane integrase YidC

  • Include specific phospholipids in growth media

• Protein aggregation during purification:

  • Optimize detergent type and concentration

  • Include glycerol (10-20%) in all buffers

  • Maintain physiologically relevant salt concentration (0.4 M NaCl)

Monitoring protein quality at each step using analytical size exclusion chromatography provides early detection of aggregation issues. For storage, the protein is most stable in Tris-based buffer with 50% glycerol , which prevents freeze-thaw damage during extended storage.

How can researchers address challenges in measuring kinetic parameters for membrane-bound enzymes like P. atlantica ubiA?

Accurate kinetic characterization of membrane-associated enzymes like ubiA requires specialized methodological approaches:

• Substrate solubility challenges:

  • Use mixed micelle systems to present hydrophobic substrates

  • Determine critical micelle concentration for each detergent-substrate mixture

  • Correct for partition coefficients of substrates between aqueous and micellar phases

• Reaction monitoring techniques:

  • Develop HPLC methods with appropriate internal standards

  • Consider continuous assays using fluorescent substrate analogs

  • Implement radiolabeled substrate approaches for highest sensitivity

• Data analysis considerations:

  • Apply appropriate models for membrane enzyme kinetics (surface dilution kinetics)

  • Account for substrate depletion in micellar phase

  • Correct for detergent effects on enzyme activity

When analyzing kinetic data, researchers should be aware that apparent Km values for membrane enzymes often depend on the specific detergent environment, making direct comparison between different experimental systems challenging without appropriate normalization.

What are current knowledge gaps regarding P. atlantica ubiA and future research directions?

Despite advances in understanding P. atlantica ubiA, significant knowledge gaps remain. Future research should address:

• Structural biology: Determine high-resolution crystal structure to elucidate the catalytic mechanism

• Regulation: Investigate transcriptional and post-translational regulation of ubiA in response to environmental conditions

• Metabolic integration: Clarify the role of ubiA in coordinating primary metabolism with specialized metabolite production

• Ecological significance: Explore the contribution of ubiA to P. atlantica's adaptation to specific marine niches

Methodological approaches for addressing these gaps include applying cryo-EM for structural determination, ChIP-seq for identifying regulatory elements, and metabolic flux analysis for understanding pathway integration. The development of genetic tools for Pseudoalteromonas will be crucial for in vivo functional studies.

How can findings from P. atlantica ubiA research be applied to biotechnological applications?

Research on P. atlantica ubiA has potential biotechnological applications that extend beyond basic science:

• Engineered biosynthetic pathways for novel prenylated compounds

• Development of marine-derived enzymes with unique substrate specificities or stability properties

• Production of specialized ubiquinone derivatives for pharmaceutical applications

• Creation of biocatalysts for industrial prenylation reactions