Recombinant Pseudoalteromonas atlantica ATP synthase subunit b 2 (atpF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; Patl_4299; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
atpF2
Target Protein Sequence
MNINATLFGELLAFIFFVWFCMKFVWPPIMGAIEERQKKIADGLAASERGEKDLELAQAK ATEQLKEAKTQAAGIIEQAKKRGSQIVDEETQRAHQERENIIAQGHAEIEAERNRAKEDL RKQVAALAVAGAERILERQIDAAAQSDIVEKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Pseudoalteromonas atlantica atpF2?

For optimal stability and activity maintenance, recombinant Pseudoalteromonas atlantica atpF2 should be stored as follows:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Medium-term storage: -20°C in a Tris-based buffer with 50% glycerol

  • Long-term storage: -80°C in the same buffer formulation

Repeated freeze-thaw cycles should be strictly avoided as they significantly decrease protein stability. When storing at -20°C or -80°C, the protein should be in a buffer optimized for this particular protein, typically a Tris-based buffer with 50% glycerol .

What expression systems and purification protocols yield the highest quality recombinant Pseudoalteromonas atlantica atpF2?

Based on successful approaches with related proteins, the following protocol is recommended:

Expression System:

  • Escherichia coli BL21(DE3) with T7 promoter systems shows high expression levels

  • Growth at 25-30°C after induction produces better results than 37°C for proper folding

Purification Protocol:

  • Cell lysis: Sonication or French press in Tris buffer (50 mM, pH 8.0) with 300 mM NaCl

  • Initial purification: Ni-NTA affinity chromatography for His-tagged constructs

  • Secondary purification: Ion exchange chromatography (cation exchange recommended as the theoretical pI of atpF2 is basic)

  • Final polishing: Size exclusion chromatography

Yield Enhancement:

  • Addition of salt (2% NaCl) to growth media to mimic marine conditions enhances proper folding

  • Induction at OD600 = 0.6-0.8 with 0.5 mM IPTG provides optimal expression

  • Co-expression with chaperones may improve folding of this membrane-associated protein

What analytical methods are most suitable for characterizing recombinant Pseudoalteromonas atlantica atpF2?

Several complementary analytical techniques should be employed:

Biochemical Characterization:

  • SDS-PAGE: Assess purity and molecular weight (expected ~17 kDa)

  • Western blot: Confirm identity using antibodies against conserved ATP synthase epitopes

  • Circular dichroism: Analyze secondary structure composition

  • Dynamic light scattering: Evaluate protein homogeneity and aggregation state

Functional Characterization:

  • ATPase activity assays: Measure ATP hydrolysis rates in reconstituted systems

  • In-gel ATPase activity: Similar to methods described for other ATP synthase components, using lead precipitation assays

  • Binding assays: SPR or ITC to measure interaction with other ATP synthase subunits

Structural Analysis:

How can researchers effectively reconstitute functional complexes containing atpF2?

Reconstitution of functional ATP synthase complexes containing atpF2 requires careful methodological considerations:

Protocol for Functional Reconstitution:

  • Membrane protein isolation: Extract all ATP synthase components or express recombinantly

  • Detergent selection: DDM (n-Dodecyl β-D-maltoside) or digitonin works well for ATP synthase complexes

  • Liposome preparation: Use E. coli polar lipids or a defined mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin

  • Protein incorporation: Detergent removal via Bio-Beads or dialysis

  • Functional verification: Measure ATP synthesis driven by artificially imposed proton gradient

Critical Parameters:

  • Protein:lipid ratio: Optimize between 1:50 and 1:100 (w/w)

  • Buffer composition: Include 10-20 mM MgSO4 to stabilize the complex

  • Temperature: Perform reconstitution at 4°C to prevent protein denaturation

  • pH: Maintain pH 7.4-8.0 throughout the reconstitution process

How does the structure of Pseudoalteromonas atlantica atpF2 compare to other bacterial ATP synthase subunits?

Comparative analysis reveals important structural distinctions:

FeatureP. atlantica atpF2E. coli b subunitMycobacterial b subunitMitochondrial b subunit
Length156 amino acids~150 amino acidsExtended with δ fusion~210 amino acids
Domain structureMembrane + soluble domainsSimilar bipartite structureExtended with 111 aa δ fusionMore complex with additional subunits
Membrane topologySingle transmembrane spanSingle transmembrane spanSingle transmembrane spanSingle transmembrane span
Oligomeric stateHomodimer (b2)Homodimer (b2)Heterodimer (b-b')Heterodimer equivalent
FlexibilityHigh in C-terminal regionSimilarLess flexible due to fusionMost rigid structure

The peripheral stalk in P. atlantica is structurally simpler and more flexible than in mitochondrial equivalents. Notably, while mycobacterial ATP synthase has its δ subunit fused to peripheral stalk subunit b, creating a unique b-δ fusion protein with an extended 111 amino acid δ subunit, P. atlantica maintains separate subunits similar to E. coli. This structural simplicity may reflect evolutionary adaptation to marine environments .

What is the impact of environmental factors on atpF2 function and stability?

As a marine bacterium, Pseudoalteromonas atlantica has evolved specific adaptations to its environment:

Temperature Effects:

  • Optimal activity range: 15-30°C (marine environment adaptation)

  • Thermal stability: More stable at lower temperatures compared to mesophilic equivalents

  • Cold adaptation: Contains fewer proline residues and more flexible glycine residues than terrestrial bacterial homologs

pH Sensitivity:

  • Recent studies on ATP synthase at acidic pH indicate substantial conformational changes in the enzyme complex

  • At low pH (mimicking conditions in hypoxic tissues), ATP synthase reveals unique conformational states

  • Four distinct conformations occur when the ATP synthase complex is exposed to acidic environments, with three representing different stages in the reaction cycle

  • The b subunit shows altered interaction patterns with both the a subunit and the catalytic components at low pH

Salt Concentration:

  • Marine adaptation: Functions optimally at salt concentrations mimicking seawater (2-3.5% NaCl)

  • Salt bridges: Important for maintaining structural integrity

  • Unlike terrestrial bacteria, lacks KdpD turgor pressure sensor, indicating adaptation to more homogeneous salinity environments

What role does atpF2 play in Pseudoalteromonas atlantica pathogenicity and environmental adaptation?

Pseudoalteromonas atlantica is known to produce extracellular products with significant biological effects, including potential pathogenicity toward marine organisms:

Pathogenic Mechanisms:

  • ATP synthesis efficiency: Crucial for energy production during infection

  • Environmental persistence: ATP synthase adaptation to changing environmental conditions enables bacterial survival

  • Virulence factor production: Energy required for extracellular product synthesis

Studies have shown that extracellular products (ECPs) from P. atlantica can cause rapid mortality when injected into edible crabs (Cancer pagurus), with symptoms including eyestalk retraction, limb paralysis, and lack of antennal sensitivity. While ATP synthase itself is not directly secreted, its efficient function is critical for providing energy for bacterial growth and virulence factor production under various environmental conditions.

The atpF2 subunit, as part of the ATP synthase complex, contributes to these processes by enabling efficient energy production in the marine environment, particularly under changing pH, temperature, and salt conditions that may occur during colonization of host organisms .

How can heterologous expression systems be optimized for functional studies of ATP synthase components from Pseudoalteromonas atlantica?

Based on successful heterologous expression of other Pseudoalteromonas components, the following optimization strategies are recommended:

Expression System Selection:

  • E. coli BL21(DE3) with pET vector system using T7 promoter

  • Pseudoalteromonas expression hosts for native environment (requires shuttle vectors)

Vector Design Considerations:

  • Incorporate the autonomously replicating element from Pseudoalteromonas haloplanktis TAC125

  • Use shuttle vectors capable of replicating in both E. coli and Pseudoalteromonas

  • Include origin of conjugative transfer (oriT) for conjugation-based transfer

Expression Optimization:

  • Reduce induction temperature to 15-25°C

  • Include osmolytes (glycine betaine, proline) in the growth medium

  • Supplement with appropriate antibiotics (ampicillin 50-150 μg/ml, chloramphenicol 15-25 μg/ml)

  • Consider co-expression with chaperones

Genetic Tools:

  • Use synthetic suppressor tRNA genes for nonsense mutation analysis

  • Apply shuttle plasmids encoding tRNA suppressors for amber mutations

  • Consider plasmid-encoded suppressor tRNAs for glycine, histidine, phenylalanine, and proline which have shown functional activity in Pseudoalteromonas

What techniques can be used to assess interactions between atpF2 and other ATP synthase components?

Several complementary approaches can elucidate interactions:

In vitro Methods:

  • Pull-down assays: Using purified components with affinity tags

  • Surface plasmon resonance (SPR): Measure binding kinetics and affinities

  • Isothermal titration calorimetry (ITC): Determine thermodynamic parameters

  • Crosslinking mass spectrometry: Identify interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry: Map interaction regions

Structural Approaches:

  • Cryo-EM: Visualize intact complexes at near-atomic resolution

  • Native mass spectrometry: Determine stoichiometry and stability of subcomplexes

  • Blue native PAGE: Analyze intact complexes and subcomplexes

Genetic Methods:

  • Site-directed mutagenesis: Identify critical residues for interaction

  • Suppressor mutation analysis: Identify compensatory mutations

  • Split-fluorescent protein complementation: Monitor interactions in vivo

Computational Approaches:

  • Protein-protein docking: Predict interaction interfaces

  • Molecular dynamics simulations: Assess stability of modeled interactions

  • Coevolution analysis: Identify coevolving residue pairs at interfaces

How can researchers evaluate the functional impact of atpF2 mutations on ATP synthase activity?

A comprehensive approach to assessing mutational effects includes:

Mutation Design Strategy:

  • Target conserved residues identified through multiple sequence alignment

  • Focus on regions with predicted structural or functional importance

  • Create alanine scanning mutants for systematic analysis

  • Design specific mutations based on homology to well-characterized ATP synthases

Functional Assays:

  • ATP synthesis activity: Measure ATP production in reconstituted proteoliposomes

  • ATP hydrolysis: Quantify phosphate release using colorimetric assays

  • In-gel ATPase activity: Visualize activity using lead precipitation

  • Proton pumping: Monitor pH changes using pH-sensitive fluorescent dyes

Structural Impact Assessment:

  • Thermal stability assays: Determine changes in melting temperature

  • Limited proteolysis: Identify alterations in domain structure

  • Circular dichroism: Detect changes in secondary structure

  • Blue native PAGE: Assess complex assembly and stability

Data Analysis Framework:

  • Compare mutant activities as percentage of wild-type function

  • Correlate functional defects with structural location of mutations

  • Classify mutations as affecting assembly, catalysis, or coupling

  • Integrate findings with existing knowledge of ATP synthase mechanism

What methods can be used to investigate the role of atpF2 in bacterial adaptation to different environmental conditions?

To understand environmental adaptation mechanisms:

Growth and Physiology Studies:

  • Cultivate bacteria under varying conditions (temperature, pH, salinity)

  • Measure growth rates, ATP levels, and membrane potential

  • Compare wild-type and atpF2 mutants (if available)

Gene Expression Analysis:

  • RT-qPCR: Quantify atpF2 expression under different conditions

  • RNA-Seq: Examine global transcriptional response

  • Promoter-reporter fusions: Monitor expression in real-time

Protein Adaptation Analysis:

  • Compare atpF2 sequences from different Pseudoalteromonas strains/species

  • Identify adaptive mutations in strains from different environments

  • Perform site-directed mutagenesis to introduce or revert adaptive changes

Structural Biology Approaches:

  • Determine ATP synthase structure under different conditions

  • Compare conformational states using cryo-EM or other techniques

  • Analyze pH-dependent conformational changes as observed in recent studies

The ATP synthase complex exhibits unique conformational states at acidic pH, which may be relevant to adaptation to environmental stress. Recent studies have identified four distinct conformations when ATP synthase is exposed to acidic environments, providing insights into how this enzyme operates under diverse conditions .

This FAQ document is intended to provide researchers with authoritative information on Pseudoalteromonas atlantica ATP synthase subunit b 2 (atpF2). The methodologies described represent current best practices in the field, though researchers should always verify information against the latest literature before designing experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.