Recombinant Pseudoalteromonas atlantica Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

CobS is a cobalamin-5′-phosphate synthase (EC 2.7.8.26) that facilitates the final steps of vitamin B₁₂ biosynthesis:

  1. Condenses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate (AdoCbl-5′-P) .

  2. Requires subsequent dephosphorylation by CobC phosphatase to yield active adenosylcobalamin (AdoCbl) .

Overexpression and Cellular Effects

  • Proton Motive Force (PMF) Dissipation: Overexpression of CobS in E. coli disrupts PMF, leading to membrane depolarization and increased ethidium bromide (EtBr) uptake, indicative of compromised membrane integrity .

  • Cell Filamentation: Elevated CobS levels impair cell division, resulting in elongated cells lacking septa (Fig. 1) .

  • Rescue Mechanisms: Co-expression with CobC (phosphatase) or PspA (phage shock protein A) restores PMF and viability by stabilizing membranes and processing toxic intermediates .

In Vitro Synthesis

  • Pathway Reconstitution: CobS, combined with CobU (AdoCbi-GDP synthase) and CobT (α-ribazole-5′-phosphate synthase), synthesizes AdoCbl-5′-P in vitro (Fig. 2) .

  • Enzyme Specificity: CobS preferentially uses α-ribazole-5′-phosphate over dephosphorylated α-ribazole, highlighting its role in phosphate retention during cobalamin assembly .

Comparative Insights

FeatureP. atlantica CobSSalmonella typhimurium CobS
Host ExpressionE. coli with His tag Native expression
Substrate SpecificityAdoCbi-GDP + α-ribazole-5′-P AdoCbi-GDP + α-ribazole-5′-P
Regulatory PartnersCobC, PspA CobC, CobT

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Patl_1138; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
cobS
Target Protein Sequence
MTRFLNYQFNLILLAVSFFTRLPVPTAIDYSPQKLHQAGRYFPLVGWLLAALLSAFYCFM LPYLGREPTVCLLIIFSLMLTGAIHEDGLADTADGFWGGQSITRKLTIMKDSQIGTYGTC ALICALLSKFILLSSLAADQHLLLALAIAYPLSRGLAISHVQHLAYARKNSDNSKSDSLA QPMQPRVLLWLLASSVPAVLWLPLSSAILVIVSACVLRFALKHWFKKHIDGYTGDCLGFA QQTQELLIYLLLIITLPKTVNEQTIGFLL
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from *Pseudoalteromonas atlantica* catalyzes the final two steps in the biosynthesis of cobalamin (vitamin B12):
1. It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin).
2. It synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudoalteromonas atlantica Cobalamin synthase (cobS) and its biological function?

Cobalamin synthase (cobS) is a key enzyme in the cobalamin (vitamin B12) biosynthetic pathway of the marine bacterium Pseudoalteromonas atlantica. The protein functions in the final stages of cobalamin assembly, catalyzing the attachment of the lower axial ligand to the corrin ring structure. In P. atlantica strain T6c/ATCC BAA-1087, cobS is encoded by the gene locus Patl_1138 and produces a protein consisting of 269 amino acid residues .

Cobalamin synthase plays a crucial role in enabling P. atlantica to produce true cobalamin rather than pseudocobalamin (which contains adenine instead of dimethylbenzimidazole as the lower ligand). This distinction is significant because true cobalamin can support the growth of cobalamin-dependent eukaryotic algae, while pseudocobalamin typically cannot be effectively utilized by these organisms .

How does P. atlantica cobS differ from other bacterial cobalamin synthases?

P. atlantica cobS belongs to a distinct group of cobalamin synthases found in marine heterotrophic bacteria. Unlike cyanobacterial homologs that primarily produce pseudocobalamin, P. atlantica belongs to the subset of marine bacteria that synthesize true cobalamin with dimethylbenzimidazole (DMB) as the lower ligand . The cobS protein in P. atlantica functions alongside other enzymes in the pathway, including those encoded by genes such as cobT, which activates DMB for incorporation into the final cobalamin structure.

Genomic analyses have shown that most marine heterotrophic bacteria that possess the corrin ring biosynthesis machinery (including genes like cbiA/cobB and cbiH/cobJ) also contain the genes for DMB synthesis and activation (bluB, cobT), enabling production of true cobalamin rather than pseudocobalamin . P. atlantica cobS works within this pathway to complete the synthesis of metabolically active cobalamin.

What are the optimal conditions for recombinant expression of P. atlantica cobS?

For optimal recombinant expression of P. atlantica cobS, researchers should consider the following parameters:

Expression System Selection:
Heterologous expression in E. coli is commonly used for marine bacterial proteins, with BL21(DE3) or Rosetta strains being particularly effective for membrane-associated proteins like cobS. Since cobS is a putative membrane protein based on its amino acid sequence, expression systems designed for membrane proteins may yield better results .

Expression Conditions:

  • Temperature: Lower temperatures (16-18°C) often improve folding of marine bacterial proteins

  • Induction: 0.1-0.5 mM IPTG for T7-based systems

  • Duration: 16-24 hours at reduced temperatures

  • Media supplementation: Addition of osmolytes (such as glycine betaine) can improve stability of proteins from marine organisms

Storage Considerations:
Once purified, recombinant P. atlantica cobS protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be kept at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

What functional assays can verify recombinant P. atlantica cobS activity?

To assess the functionality of recombinant P. atlantica cobS, researchers can employ the following assays:

Cobalamin Production Assays:

  • Microbiological Assays: Use cobalamin-dependent organisms (such as Salmonella enterica with a metE mutation) as indicators in growth-based assays.

  • HPLC Analysis: Monitor the conversion of cobalamin precursors to complete cobalamin using HPLC with UV-visible detection at characteristic wavelengths.

  • Mass Spectrometry: LC-MS/MS can definitively identify cobalamin products and intermediates.

Enzyme Activity Assays:

  • Radioisotope Incorporation: Using labeled precursors to track the incorporation of the lower ligand into the cobalamin structure.

  • Spectrophotometric Assays: Monitoring changes in absorption spectra during the enzymatic reaction.

Complementation Studies:
Functional complementation of cobS-deficient bacterial strains can provide evidence of enzymatic activity. Expression of P. atlantica cobS in a cobS knockout strain should restore cobalamin synthesis if the recombinant protein is functional.

How can researchers distinguish between cobalamin and pseudocobalamin production?

Distinguishing between true cobalamin and pseudocobalamin production is critical for studies involving P. atlantica cobS. The following analytical methods can be employed:

Analytical Techniques:

MethodDescriptionDistinguishing Features
HPLCSeparation based on polarity and structureDifferent retention times for cobalamin vs. pseudocobalamin
LC-MS/MSMass-based detection and structural confirmationMass difference between DMB and adenine lower ligands
UV-visible spectroscopyAbsorption spectrum analysisDistinct spectral features between variants
BioassaysGrowth support for test organismsDifferent growth responses from indicator organisms

Biological Indicator Systems:
Growth assays using eukaryotic algae such as Thalassiosira pseudonana can effectively distinguish between cobalamin and pseudocobalamin. T. pseudonana can take up pseudocobalamin but cannot use it effectively for growth, showing depressed levels of S-adenosylmethionine (SAM) when provided with pseudocobalamin compared to true cobalamin .

What genetic methods can be used to manipulate cobS in P. atlantica?

For genetic manipulation of cobS in P. atlantica, researchers can utilize several approaches:

Gene Knockout Strategies:

  • Homologous recombination-based gene replacement

  • CRISPR-Cas9 genome editing tailored for marine bacteria

  • Transposon mutagenesis for random insertional inactivation

Expression Manipulation:

  • Controlled expression using inducible promoters

  • Reporter gene fusions to monitor cobS expression

  • Site-directed mutagenesis to create specific variants

When performing genetic manipulation in P. atlantica, researchers should consider potential unique features of marine bacterial genetics, including potential insertion sequences that might affect genetic stability, such as the IS492 element identified in P. atlantica that controls phase variation in extracellular polysaccharide production .

How does cobS function within the broader context of cobalamin biosynthesis pathways?

Cobalamin synthase (cobS) operates within a complex biosynthetic pathway involving multiple enzymes. In P. atlantica and other true cobalamin producers, the pathway includes:

  • Corrin Ring Biosynthesis: Involving enzymes encoded by genes such as cbiA/cobB and cbiH/cobJ

  • DMB Synthesis: Via the BluB pathway in oxygen-dependent organisms

  • DMB Activation: Through the action of CobT

  • Final Assembly: Where CobS attaches the activated lower ligand to the corrin ring structure

P. atlantica possesses both the corrin ring biosynthesis genes and the DMB synthesis and activation genes (such as bluB and cobT), enabling it to produce true cobalamin rather than pseudocobalamin . This pathway differs from that in cyanobacteria, which generally lack the genes for DMB synthesis and instead produce pseudocobalamin with adenine as the lower ligand.

The pathway can operate through either oxygen-dependent or oxygen-independent routes, with different enzymes catalyzing parallel reactions depending on oxygen availability. P. atlantica, as a heterotrophic marine bacterium, likely utilizes the oxygen-dependent pathway in its natural environment.

What ecological role does P. atlantica cobS play in marine microbial communities?

P. atlantica's ability to produce true cobalamin via the cobS-containing pathway has significant ecological implications:

Cobalamin Exchange Networks:
As one of the relatively few marine organisms capable of de novo cobalamin synthesis, P. atlantica likely plays a critical role in providing this essential vitamin to cobalamin auxotrophs in marine ecosystems. While cyanobacteria numerically dominate many marine environments and produce pseudocobalamin, eukaryotic algae typically require true cobalamin for growth .

Microbial Interactions:
The production of true cobalamin by heterotrophic bacteria like P. atlantica creates the foundation for cobalamin-based interdependencies that sustain community structure and function in the ocean . These bacteria may form close physical or chemical relationships with cobalamin auxotrophs, potentially explaining the frequent association of Rhodobacterales (true cobalamin producers) with eukaryotic algae .

Implications for Primary Production:
By providing bioavailable cobalamin to eukaryotic phytoplankton, P. atlantica and similar bacteria indirectly support marine primary production. The distinction between cobalamin and pseudocobalamin producers has important consequences for understanding which bacteria actually support the vitamin B12 requirements of marine primary producers.

How can heterologous expression systems be optimized for functional studies of P. atlantica cobS?

For functional studies requiring heterologous expression of P. atlantica cobS, researchers should consider these optimization strategies:

Expression System Selection:

  • E. coli-based systems: Modified strains such as C41/C43(DE3) designed for membrane protein expression may be particularly suitable.

  • Native-like hosts: Marine bacteria more closely related to P. atlantica might provide a more suitable cellular environment.

  • Cell-free systems: For avoiding potential toxicity issues associated with membrane protein overexpression.

Codon Optimization:
Marine bacteria often have different codon usage patterns than common expression hosts. Codon optimization of the cobS gene sequence for the selected expression system can significantly improve expression levels.

Fusion Partners and Solubilization Strategies:

  • N-terminal or C-terminal fusions with solubility-enhancing tags (MBP, SUMO, etc.)

  • Systematic screening of detergents for optimal solubilization

  • Nanodiscs or amphipols for maintaining native-like membrane environments

Co-expression Strategies:
Co-expression with other components of the cobalamin biosynthetic pathway may improve functionality of the recombinant cobS enzyme, especially if interactions with other pathway enzymes are required for proper folding or activity.

What are the current technical limitations in studying P. atlantica cobS?

Researchers face several challenges when studying P. atlantica cobS:

Membrane Protein Challenges:
The membrane-associated nature of cobS creates difficulties in expression, purification, and structural characterization. Obtaining sufficient quantities of properly folded, active protein remains a significant hurdle.

Functional Assay Limitations:
The complexity of the cobalamin biosynthetic pathway makes it challenging to develop simple, high-throughput assays for cobS activity. Current methods often require specialized equipment and expertise.

Genetic System Development:
While genetic manipulation of P. atlantica is possible, well-established genetic tools optimized for this organism are still developing, making genetic studies more challenging than in model organisms.

Structural Characterization:
The membrane-associated nature of cobS complicates structural studies using X-ray crystallography or cryo-EM, limiting our understanding of its precise mechanism of action.

What emerging technologies might advance research on P. atlantica cobS?

Several emerging technologies hold promise for advancing cobS research:

Structural Biology Innovations:

  • Advanced cryo-EM techniques optimized for membrane proteins

  • Hydrogen-deuterium exchange mass spectrometry for probing protein dynamics

  • Computational approaches for predicting membrane protein structures

Synthetic Biology Approaches:

  • Cell-free expression systems optimized for membrane proteins

  • Minimal synthetic pathways for studying cobS in isolation

  • CRISPR-Cas9 systems adapted for marine bacteria

Systems Biology Integration:

  • Multi-omics approaches to understand cobS regulation in various conditions

  • Metabolic flux analysis to quantify cobalamin production pathways

  • Community-level studies to understand ecological context

How might understanding P. atlantica cobS contribute to broader scientific questions?

Research on P. atlantica cobS has implications that extend beyond this specific enzyme:

Evolution of Vitamin B12 Biosynthesis:
Studying the differences between true cobalamin and pseudocobalamin biosynthesis pathways can provide insights into the evolution of these critical metabolic capabilities and their distribution across microbial lineages.

Marine Microbial Ecology:
Understanding the production of true cobalamin by heterotrophic bacteria like P. atlantica helps explain microbial interdependencies in marine ecosystems and their impact on primary production and biogeochemical cycling.

Biotechnological Applications:
Knowledge of P. atlantica cobS and the complete cobalamin biosynthetic pathway could enable engineering of improved vitamin B12 production systems or the development of novel biosensors for monitoring cobalamin availability in various environments.

Fundamental Enzymology: Mechanistic studies of cobS contribute to our understanding of complex enzymatic transformations involving metallocofactors and coordination chemistry in biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.