Recombinant Pseudoalteromonas atlantica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudoalteromonas atlantica Glycerol-3-Phosphate Acyltransferase (plsY)

Recombinant Pseudoalteromonas atlantica glycerol-3-phosphate acyltransferase (plsY) is a bioengineered enzyme derived from the marine bacterium P. atlantica. This protein catalyzes the transfer of fatty acyl groups to glycerol-3-phosphate (G3P), a critical step in bacterial phospholipid biosynthesis. The enzyme is encoded by the plsY gene (UniProt ID: Q15X19) and is commercially available as a recombinant product expressed in E. coli with an N-terminal His-tag for purification .

Physiological Role and Biochemical Function

plsY belongs to the lysophosphatidic acid acyltransferase (LPAAT) family, which acylates lysophosphatidic acid (LPA) to form phosphatidic acid (PA), a precursor for phospholipids. In P. atlantica, this enzyme likely contributes to membrane lipid synthesis, enabling adaptation to marine environments .

Mechanistic Insights:

  • Substrate Specificity: LPAATs typically utilize long-chain fatty acyl-CoA derivatives. While P. atlantica plsY’s substrate preferences are not explicitly documented, homologs in γ-proteobacteria (e.g., Shewanella) show preferences for branched or unsaturated fatty acids .

  • Regulatory Context: In P. atlantica, phase variation of extracellular polysaccharide (EPS) synthesis is regulated by IS492 excision , though plsY’s direct role in EPS production remains uncharacterized.

Research Applications and Significance

Recombinant plsY serves as a tool for studying bacterial lipid metabolism. Potential applications include:

  • Lipid Biosynthesis Studies: Investigating acyltransferase specificity and membrane adaptation mechanisms .

  • Biotechnological Applications: Engineering microbial strains for tailored phospholipid production.

  • Structural Biology: Crystallographic or NMR studies to elucidate substrate binding and catalytic mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
plsY; Patl_1043; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
plsY
Target Protein Sequence
MTSLSILLFCSAYLLGSISSAVLICRVFMLPDPRKTGSNNPGATNVLRIGGRLPAALVFI FDVLKGTLPVYVGYLLGMPPITLGLVGIAACLGHIYPLYFNFNGGKGVATAIGAMLPLGW ELVSLLLACWLVIVFITGYSSLAAIISVSVAPFITWFVKPAYTAPVTMLCILIIVRHRQN IIRLMSGQESKIWDKGRTKE
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudoalteromonas atlantica and why is it significant in research?

Pseudoalteromonas atlantica is a gram-negative marine bacterium that produces extracellular polysaccharide (EPS), which plays a crucial role in biofilm formation. This organism belongs to the Pseudoalteromonas genus, which encompasses marine bacteria often found in association with other organisms. The genus demonstrates high phylogenetic diversity and a notably clonal structure, with mutation being more frequent than recombination in its evolutionary processes. Pseudoalteromonas species are particularly significant in research due to their antimicrobial properties and their adaptation to marine environments. The bacteria's ability to form biofilms through EPS production makes it an excellent model for studying bacterial colonization mechanisms and marine microbial ecology .

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in bacterial systems?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that catalyzes a critical step in bacterial membrane phospholipid biosynthesis. Specifically, plsY transfers an acyl group from acylphosphate to glycerol-3-phosphate, which initiates the formation of phosphatidic acid, a precursor to all glycerophospholipids in bacterial membranes. This enzymatic reaction occurs after acyl-acyl carrier protein is converted to acylphosphate by PlsX in the most widely distributed biosynthetic pathway for bacterial membrane phospholipid formation. The process is fundamental to bacterial cell envelope integrity and function, making plsY an essential enzyme for bacterial survival and growth .

What structural features characterize PlsY and how do they relate to function?

PlsY exhibits a complex membrane topology with five membrane-spanning segments. The protein's amino terminus and two short loops are positioned on the external face of the membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs critical for catalytic activity. Each conserved domain contributes distinctly to PlsY function:

  • Motif 1 contains essential serine and arginine residues crucial for catalysis

  • Motif 2 displays characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site

  • Motif 3 includes a conserved histidine and asparagine important for activity, plus a glutamate critical to the structural integrity of the enzyme

Mutations in these conserved regions significantly impact enzyme function. For example, mutations of the conserved glycines in motif 2 to alanines result in a K​m defect for glycerol-3-phosphate binding, confirming its role as the substrate binding site .

What expression systems are optimal for recombinant Pseudoalteromonas atlantica plsY?

While Escherichia coli remains the most commonly used expression system for recombinant proteins, it presents significant limitations for certain proteins, including those from psychrophilic (cold-adapted) organisms like Pseudoalteromonas atlantica. Two primary expression systems have been documented:

1. E. coli expression system:

  • Advantages: Well-established protocols, high protein yields, rapid growth

  • Limitations: May lead to improper folding or inactivity of cold-adapted proteins

  • For P. atlantica plsY specifically: Successfully expressed with a His-tag in E. coli as evidenced by commercially available recombinant protein

2. Cold-adapted Pseudoalteromonas expression system:

  • Advantages: Better suited for expression of cold-adapted enzymes, allows proper protein folding and post-translational modifications at lower temperatures (10-15°C)

  • Methodology: Utilizes a shuttle vector system with specific promoters active at low temperatures, such as the xylanase gene promoter from Pseudoalteromonas sp. BSi20429

  • Induction: Typically uses 2% oat spelt xylan as an inducer at 10-15°C for approximately 48 hours

  • Particularly useful for: Proteins that cannot mature by autoprocessing in E. coli

For optimal expression of functionally active P. atlantica plsY, selecting an appropriate expression system based on downstream applications and protein characteristics is essential .

How does the cold-adapted Pseudoalteromonas expression system compare to E. coli for expression of psychrophilic membrane proteins?

The cold-adapted Pseudoalteromonas expression system offers significant advantages over the E. coli system specifically for psychrophilic membrane proteins like plsY:

FeatureCold-adapted Pseudoalteromonas SystemE. coli System
Expression temperature10-15°C optimal25-37°C typical
Proper folding of psychrophilic proteinsEnhanced at low temperaturesOften compromised
Membrane protein integrationNative-like membrane environmentOften forms inclusion bodies
Autoprocessing capabilityAllows natural maturation processesLimited for some proteins
Expression yieldModerate (e.g., 1.2 mg/L for pseudoalterin)Variable, often higher
Time requiredLonger (typically 48 hours)Shorter (typically 4-24 hours)
Promoter efficiency at low tempsHigh with xylanase promoterLow with standard promoters (e.g., Plac)

What purification strategies are most effective for recombinant plsY proteins?

Purification of recombinant plsY requires specialized approaches due to its nature as an integral membrane protein. Based on available research data, the following purification strategy has proven effective:

Step 1: Affinity tag selection and placement

  • His-tagging is the most documented approach for P. atlantica plsY purification

  • The tag is typically attached to the N-terminus of the protein to avoid interfering with membrane integration

Step 2: Extraction from membrane

  • Gentle solubilization using appropriate detergents is critical

  • Commonly used detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin to maintain protein stability

Step 3: Affinity chromatography

  • Ni-NTA affinity chromatography has been successfully employed for His-tagged plsY

  • Optimized binding buffer typically contains low concentrations of imidazole (10-20 mM) to reduce non-specific binding

  • Elution performed with an imidazole gradient (typically 50-250 mM)

Step 4: Quality assessment

  • SDS-PAGE analysis to confirm purity (>90% purity is achievable)

  • Western blotting to verify identity

  • Activity assays to ensure functional integrity

For optimal results, all purification steps should be performed at reduced temperatures (4°C) to maintain the stability of this cold-adapted enzyme .

How can site-directed mutagenesis be applied to study plsY functional domains?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in plsY. Based on research on bacterial plsY (including studies in Streptococcus pneumoniae), the following methodological framework is recommended:

Target selection strategy:
Focus mutagenesis on the three highly conserved motifs identified in the cytoplasmic domains of plsY:

  • Motif 1 mutational targets:

    • Conserved serine and arginine residues demonstrated to be essential for catalysis

    • Substitution approaches: Ser→Ala to eliminate hydroxyl group; Arg→Lys to maintain charge but alter size

  • Motif 2 mutational targets (glycerol-3-phosphate binding site):

    • Conserved glycine residues that form the phosphate-binding loop

    • Gly→Ala mutations result in specific Km defects for glycerol-3-phosphate binding

    • Systematic substitutions of surrounding residues can map the complete binding pocket

  • Motif 3 mutational targets:

    • Conserved histidine and asparagine (important for activity)

    • Critical glutamate (essential for structural integrity)

    • His→Ala and Asn→Ala substitutions to assess catalytic roles

    • Glu→Asp to test structural requirements while maintaining charge

Functional assessment methodology:

  • Enzymatic activity assays measuring the transfer of acyl groups to glycerol-3-phosphate

  • Kinetic parameter determination (Km, Vmax) to differentiate binding vs. catalytic defects

  • Thermal stability assessments to identify structural vs. functional mutations

  • Inhibition studies using palmitoyl-CoA, a known non-competitive inhibitor

This approach has successfully distinguished between residues involved in substrate binding, catalysis, and structural integrity, providing crucial insights into plsY function .

What role might plsY play in biofilm formation in Pseudoalteromonas atlantica?

The connection between plsY and biofilm formation represents an emerging area of research interest. While direct experimental evidence linking plsY to P. atlantica biofilm formation is not fully established, a compelling hypothesis can be constructed based on integrated information:

  • Phospholipid composition and membrane properties:

    • PlsY catalyzes a rate-limiting step in phospholipid biosynthesis, potentially affecting membrane fluidity and composition

    • Altered membrane properties can influence cell surface adhesion properties and cell-cell interactions in biofilms

  • Connection to extracellular polysaccharide (EPS) production:

    • P. atlantica produces EPS that is critical for biofilm formation

    • The insertion and precise excision of IS492 at a locus essential for EPS production controls phase variation of EPS production

    • Membrane composition may influence the expression or functionality of proteins involved in EPS biosynthesis and export

  • Environmental adaptation through membrane remodeling:

    • As a marine bacterium, P. atlantica encounters variable environmental conditions

    • plsY activity might be regulated to adjust membrane composition in response to environmental cues that trigger biofilm formation

Research methodology to explore this connection would ideally include:

  • Constructing plsY conditional mutants to assess biofilm formation capacity

  • Analyzing phospholipid profiles of P. atlantica during planktonic vs. biofilm growth phases

  • Investigating potential interactions between plsY and proteins involved in EPS production

This research direction holds promise for uncovering novel mechanisms linking basic phospholipid metabolism to complex bacterial community behaviors .

How does temperature affect the activity and structure of Pseudoalteromonas atlantica plsY?

As a protein from a marine bacterium, P. atlantica plsY is expected to display distinct temperature-dependent characteristics reflecting its adaptation to cold marine environments. Although the specific temperature profile of P. atlantica plsY is not directly presented in the available research, a methodological approach to characterize its temperature-dependent properties would include:

Enzymatic activity profiling:

  • Measure plsY activity across a temperature range (0-40°C)

  • Determine temperature optima and calculate activation energy (Ea) from Arrhenius plots

  • Compare with mesophilic homologs to quantify cold-adaptation

Structural stability assessment:

  • Circular dichroism (CD) spectroscopy to monitor secondary structure changes with temperature

  • Differential scanning calorimetry (DSC) to determine melting temperature (Tm)

  • Intrinsic fluorescence measurements to detect subtle conformational changes

Molecular flexibility analysis:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess regional flexibility differences at various temperatures

  • Molecular dynamics simulations to identify temperature-sensitive regions

Existing research on cold-adapted Pseudoalteromonas proteins indicates they typically show:

  • Higher catalytic efficiency at low temperatures (10-15°C)

  • Lower thermal stability compared to mesophilic homologs

  • Increased flexibility in regions surrounding the active site

These methodological approaches would provide insights into how P. atlantica plsY has adapted to function in cold marine environments, with potential applications in biotechnology and understanding membrane biogenesis in psychrophilic organisms .

How can researchers address protein insolubility when expressing recombinant Pseudoalteromonas atlantica plsY?

The insolubility of membrane proteins like plsY presents a significant challenge in recombinant expression systems. Based on experiences with similar proteins, the following methodological approaches can address this issue:

Expression system optimization:

  • Cold-adapted expression system advantage

    • Use of the Pseudoalteromonas expression system at 10-15°C

    • Implementation of the xylanase promoter from Pseudoalteromonas sp. BSi20429

    • Induction with 2% oat spelt xylan for 48 hours

  • E. coli system modifications

    • Use of specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

    • Reduced induction temperature (16-20°C) and IPTG concentration (0.1-0.5 mM)

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

Fusion tag strategies:

  • N-terminal fusion tags have been successful for plsY expression

  • His-tag: Enables purification but may not enhance solubility

  • Consider testing larger solubility-enhancing tags (MBP, SUMO) while recognizing they may interfere with membrane integration

Solubilization approaches:

  • Selection of appropriate detergents is critical for extracting functional protein

  • A detergent screening panel is recommended (DDM, LDAO, digitonin, etc.)

  • Incorporate stabilizing additives (glycerol 10-20%, specific lipids) in extraction buffers

Comparative success rates:
When expressing pseudoalterin (another protein from Pseudoalteromonas):

  • E. coli with His-tag: Formed insoluble inclusion bodies

  • E. coli with GST-tag: Soluble but remained in precursor form (~70 kDa)

  • Pseudoalteromonas system: Successfully expressed in mature, active form

This troubleshooting framework demonstrates the importance of selecting appropriate expression systems and conditions for challenging membrane proteins like P. atlantica plsY.

What methods can be employed to accurately determine plsY enzymatic activity?

Accurately measuring enzymatic activity of membrane-associated acyltransferases like plsY presents unique methodological challenges. Based on established approaches for related enzymes, the following methodological framework is recommended:

Activity assay options:

  • Radiolabeled substrate approach

    • Substrate: [14C]Glycerol-3-phosphate and acyl-phosphate

    • Detection: Measure incorporation of radiolabel into lysophosphatidic acid

    • Advantages: High sensitivity and specificity

    • Limitations: Radiation safety concerns, specialized equipment needed

  • Coupled spectrophotometric assay

    • Principle: Link plsY activity to consumption or production of NADH

    • Implementation: Couple release of inorganic phosphate to enzymatic reactions that ultimately affect NADH levels

    • Detection: Monitor absorbance changes at 340 nm

    • Advantages: Real-time measurement, no radioactivity

    • Limitations: Potential interference from coupling enzymes

  • Fluorescence-based methods

    • Use of fluorescent-labeled glycerol-3-phosphate analogues

    • Detection: HPLC separation with fluorescence detection

    • Advantages: High sensitivity, no radioactivity

    • Limitations: Modified substrates may alter enzyme kinetics

Assay optimization considerations:

  • Detergent selection and concentration critical for maintaining enzyme activity

  • Inclusion of appropriate phospholipids to provide native-like membrane environment

  • Temperature control (10-15°C optimal for cold-adapted enzymes)

  • pH optimization (typically pH 7.0-8.0 for membrane-associated enzymes)

Control experiments:

  • Heat-inactivated enzyme controls

  • Known plsY inhibitor controls (palmitoyl-CoA acts as a non-competitive inhibitor)

  • Substrate specificity verification using various acyl donors

These methodological approaches provide a comprehensive framework for reliably measuring plsY activity while addressing the specific challenges associated with membrane protein enzymology.

How can contradictory results in plsY functional studies be reconciled?

When encountering contradictory results in plsY functional studies, researchers should implement a systematic troubleshooting and reconciliation approach:

1. Experimental condition analysis:

  • Temperature effects: Cold-adapted enzymes like those from Pseudoalteromonas may show dramatically different activities at different temperatures

  • Expression system influence: Compare results from E. coli vs. Pseudoalteromonas expression systems

  • Membrane environment differences: Detergent type, concentration, and lipid composition significantly impact membrane protein behavior

2. Protein preparation assessment:

  • Verify protein integrity through mass spectrometry

  • Confirm correct folding through circular dichroism

  • Evaluate oligomeric state using size-exclusion chromatography

  • Check for post-translational modifications that might differ between expression systems

3. Methodological standardization:

  • Standardize enzyme concentration determination methods

  • Normalize activity to protein amount rather than crude extract volume

  • Establish consistent substrate preparation protocols

  • Implement internal standards in activity assays

4. Data interpretation framework:

  • Consider evolutionary context (plsY from psychrophilic vs. mesophilic organisms)

  • Analyze possible existence of isoenzymes or redundant pathways

  • Evaluate enzyme behavior in biological context vs. in vitro systems

Case example from related research:
When pseudoalterin was studied, contradictory results were observed between expression systems:

  • In E. coli: Non-functional protein despite solubility with GST-tag

  • In Pseudoalteromonas: Fully functional enzyme with correct N-terminal processing

  • Reconciliation: Recognition that autoprocessing mechanism required specific conditions only present in the native-like expression system

This methodological framework enables researchers to systematically investigate and reconcile contradictory results in plsY studies, advancing understanding of this important enzyme family.

What are promising approaches for structural studies of membrane-associated plsY?

Determining the three-dimensional structure of membrane proteins like plsY remains challenging but is crucial for understanding their function. Based on current methodological advances, the following approaches are most promising:

Cryo-electron microscopy (cryo-EM):

  • Advantages: Requires less protein, maintains native-like environment

  • Methodology: Expression in sufficient quantities, purification in appropriate detergents, grid preparation optimization

  • Recent advances: Single-particle analysis techniques have improved resolution for membrane proteins

  • Special considerations: May need to increase molecular weight through fusion partners or antibody fragments

X-ray crystallography approaches:

  • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

  • In meso crystallization methods that maintain the membrane protein in a lipid bilayer

  • Fusion with crystallization chaperones (e.g., T4 lysozyme) to increase polar surface area

  • Systematic detergent screening to identify conditions promoting crystal formation

NMR spectroscopy for specific domains:

  • Solution NMR for soluble domains

  • Solid-state NMR for membrane-embedded regions

  • Selective isotopic labeling strategies

Integrative structural biology:

  • Combining lower-resolution structural data with computational modeling

  • Molecular dynamics simulations in membrane environments

  • Evolutionary covariance analysis to predict structural constraints

Expression optimization for structural studies:

  • Scale-up of the cold-adapted Pseudoalteromonas expression system

  • Construct optimization (removal of flexible regions, thermostabilizing mutations)

  • Systematic detergent screening for optimal extraction and stability

These methodological approaches represent the current state-of-the-art for structural studies of challenging membrane proteins like P. atlantica plsY .

How might genetic manipulation of plsY contribute to understanding Pseudoalteromonas atlantica biofilm formation?

Targeted genetic manipulation of plsY offers powerful approaches to elucidate its role in P. atlantica biofilm formation. The following methodological framework outlines promising strategies:

Genetic modification approaches:

  • Gene knockout/knockdown systems

    • CRISPR-Cas9 based editing in Pseudoalteromonas

    • Antisense RNA strategies for temporal control

    • Conditional expression systems using the xylanase promoter from Pseudoalteromonas

  • Site-directed mutagenesis targets

    • Catalytic residues in Motifs 1-3 to create activity-deficient variants

    • Substrate binding site alterations to modify specificity

    • Regulatory region modifications to alter expression patterns

  • Reporter fusion constructs

    • plsY-promoter fusions to fluorescent proteins to monitor expression

    • Translational fusions to assess localization during biofilm formation

Implementation methodology:

  • Utilize the established conjugational transfer system between E. coli and Pseudoalteromonas

  • Employ the shuttle vector pOriT-4CM that replicates in both organisms

  • Achieve transfer frequency of ~4×10^-3 transconjugants per donor cell

  • Select transconjugants using ampicillin and chloramphenicol resistance

Phenotypic analysis approaches:

  • Quantitative biofilm assays (crystal violet staining, confocal microscopy)

  • EPS production measurement correlated with plsY expression/activity

  • Phospholipid compositional analysis using LC-MS/MS

  • Correlation between membrane composition changes and biofilm formation stages

Experimental design considerations:

  • Temperature control critical for cold-adapted enzyme function (10-15°C optimal)

  • Environmental factors affecting Pseudoalteromonas biofilm formation

  • Potential connection to IS492 excision mechanisms regulating EPS production

This research direction could significantly advance understanding of how fundamental membrane biosynthesis processes connect to complex bacterial behaviors like biofilm formation in marine environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.