Recombinant Pseudoalteromonas atlantica Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
msbA; Patl_1780; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
msbA
Target Protein Sequence
MTHTLPTQNVFKRFAVYLKDFKLAFGVAIIGMVGYSLIDAYVISLLQPIIDGNGGKWDYD YLRIAAYFVIPVFIARGIFNFMGTYTLSWISSQVVMKMREQLFHQYMHLPVEFHDHHPSG QLISKVIYDTEQVAGAAGKAFLTLVREGALVFGLLFWMFYHSWQLSLVFILIGPLVAMIV SVVSKRFRLVSKNIQQAMGNLTSSAEQIIKGHKVVLMFGGQDLEASRFAKKNNNNRQQNM KLVIAQILSVSSIQVIASVALAVVLYISSKPNFITDLTPGTFVTVVVAMTMLLKPLKQLT TVNSEFQKGMAACVSIFSVLDNAIEKDTGSKVLDKAKGKLEFRDVTFHYPNKEEAALSDM SFTVEPGKTFALVGRSGSGKSTISSLLTRFYDAQQGTILLDDVPLQDFKLKDLRRQFALV SQHVTLFNDTIANNIAYGSEGRVTPEQVLAAAKTAHALEFIEQLPNGMETLIGENGLMLS GGQRQRLAIARAVLLDAPVLILDEATSALDTESERLIQDALETLQQDRTSIVVAHRLSTI ESADQILVIERGRILEQGDHASLLSEDGAYAQLHKLQFGDGQTDA
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. Its function includes translocating the lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MsbA in Gram-negative bacteria?

MsbA is an essential ATP-binding cassette (ABC) transporter that transports lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane in Gram-negative bacteria . This translocation is a critical step in the biogenesis of the bacterial outer membrane, making MsbA essential for bacterial viability. The protein functions as a lipid flippase, moving amphipathic molecules across the membrane bilayer against concentration gradients, utilizing ATP hydrolysis to power this energetically unfavorable process.

What is the structural characterization of Pseudoalteromonas atlantica MsbA?

P. atlantica MsbA (Q15UY7) is a 585-amino acid protein that follows the canonical ABC transporter architecture . Like other MsbA homologs, it contains:

  • Transmembrane domains (TMDs) that form the substrate binding chamber and transport pathway

  • Nucleotide-binding domains (NBDs) that bind and hydrolyze ATP

  • A central binding chamber where both lipids and drugs interact with the protein

  • Coupling helices that transmit conformational changes between the NBDs and TMDs

The X-ray structure of MsbA from related species (e.g., Salmonella typhimurium) shows an inward-facing conformation with a large amplitude opening in the transmembrane portal, which is likely required for lipid access . This structural information can be extrapolated to understand the general architecture of P. atlantica MsbA.

How does the amino acid sequence of P. atlantica MsbA compare with homologs from other bacterial species?

When comparing P. atlantica MsbA (585 aa) with Rhodoferax ferrireducens MsbA (581 aa), we observe both conservation and divergence:

The sequence conservation is highest in functional domains involved in ATP binding and hydrolysis, while greater variation exists in the transmembrane regions, likely reflecting adaptations to different membrane environments or substrate specificities .

What are the energy requirements for different lipid substrate transport by MsbA?

The energetics of lipid transport by MsbA show a fascinating substrate-dependent pattern:

Lipid SubstrateATP RequirementProton Gradient Requirement
1,2-dioleoyl (C18)-phosphatidylethanolamineRequiredRequired
Hexa-acylated (C12-C14) Lipid-ARequiredNot required

This differential energy requirement demonstrates that MsbA adapts its transport mechanism based on the specific physical properties of its substrates . The simultaneous requirement for ATP and a proton gradient for certain phospholipids suggests a more complex, energetically demanding process for these substrates, while the ATP-only dependence for Lipid-A transport may reflect different structural accommodations or transport kinetics. These findings have significant implications for understanding the bacterial energy budget and for targeting MsbA function in antimicrobial development.

How does the inward-facing conformation of MsbA facilitate lipid A transport?

The inward-facing conformation of MsbA, as revealed by X-ray crystallography, features a large amplitude opening in the transmembrane portal . This conformation is crucial for the initial stage of the transport cycle because:

  • It creates an accessible pathway from the cytoplasmic leaflet where lipid A is synthesized

  • The large cavity accommodates the bulky lipid A molecule with its multiple acyl chains

  • This conformation positions key residues for substrate recognition and binding

  • The arrangement of transmembrane helices in this state creates a hydrophobic environment that can accommodate the lipid substrate

During the transport cycle, ATP binding drives the transition from this inward-facing state to an outward-facing conformation, which repositions the lipid substrate toward the periplasmic leaflet. The inward-facing conformation thus represents a critical "starting point" for the transport mechanism.

What is the relationship between lipid transport and drug export functions of MsbA?

MsbA exhibits dual functionality as both a lipid transporter and a multidrug exporter. Research indicates that:

  • Both lipid and drug transport occur via the same central binding chamber in MsbA

  • The lipid availability in the membrane can affect drug transport activity and vice versa

  • This suggests potential competitive or allosteric interactions between these two substrate classes

  • The functional overlap may explain how MsbA contributes to intrinsic antibiotic resistance in some bacteria

This relationship highlights the evolutionary adaptation of ABC transporters to accommodate multiple substrate types and suggests that membrane lipid composition could modulate drug efflux activity. For researchers, this interaction means that experimental design must carefully consider the lipid environment when studying drug transport activities of MsbA.

How do mutations in critical residues affect the transport activity of MsbA?

Mutational analysis provides valuable insights into structure-function relationships in MsbA:

RegionEffect of MutationsFunctional Implications
Walker A/B motifsSeverely reduce or abolish transportCritical for ATP binding/hydrolysis
Central binding chamberAlter substrate specificityInvolved in substrate recognition
Transmembrane helicesAffect conformational changesImportant for creating transport pathway
NBD-TMD interfaceDisrupt domain communicationCritical for coupling ATP hydrolysis to transport

Studies indicate that mutations affecting the central binding chamber can influence both lipid and drug transport activities . These findings help identify critical residues for substrate specificity and transport efficiency, providing potential targets for inhibitor design and enhancing our understanding of the molecular mechanism of transport.

What expression systems are optimal for producing functional recombinant MsbA?

Successful expression of functional MsbA requires careful consideration of expression systems:

Expression SystemAdvantagesConsiderations
E. coliWell-established for MsbA expression; Both P. atlantica and R. ferrireducens MsbA successfully expressed May require specialized strains; Lower temperature induction often beneficial
Lactococcus lactisDifferent membrane composition; Used in MsbA research Different codon usage; May require optimization

Key optimization parameters include:

  • Induction temperature (typically lowered to 18-25°C)

  • Inducer concentration and duration

  • Addition of membrane-stabilizing agents

  • Fusion tags (His-tag commonly used for purification)

The choice of expression system should be guided by the specific experimental requirements, desired yield, and downstream applications.

What purification strategies maintain MsbA in its native conformation?

Purification of MsbA requires specialized approaches to maintain structural integrity:

  • Membrane isolation and solubilization:

    • Careful selection of detergents (mild detergents like DDM or LMNG preferred)

    • Addition of lipids during solubilization to stabilize the protein

  • Affinity chromatography:

    • Utilizing the N-terminal His-tag commonly incorporated in recombinant constructs

    • Careful selection of imidazole concentrations to minimize non-specific binding while maximizing yield

  • Storage conditions:

    • Lyophilized powder form for long-term stability

    • Reconstitution in deionized water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol and aliquoting for storage at -20°C/-80°C

    • Avoiding repeated freeze-thaw cycles

  • Quality assessment:

    • SDS-PAGE analysis for purity (>90% typically achievable)

    • ATPase activity assays to confirm functional integrity

    • Circular dichroism to verify secondary structure integrity

These strategies ensure that the purified MsbA protein retains its native structure and functional capabilities for subsequent biochemical and biophysical analyses.

What reconstitution methods are effective for studying MsbA transport activity in vitro?

Reconstitution of MsbA into proteoliposomes is essential for functional transport studies:

  • Proteoliposome preparation:

    • Mixing purified MsbA with lipids in appropriate ratios

    • Detergent removal via dialysis, Bio-Beads, or other methods

    • Control of protein orientation (typically random unless specialized techniques are used)

  • Lipid considerations:

    • Choice of lipids affects transport activity

    • Energy requirements are lipid-dependent

    • Typical compositions include E. coli polar lipids or defined mixtures of synthetic phospholipids

  • Assay setup for energy-dependent transport:

    • ATP regeneration systems to maintain ATP levels

    • Creation of proton gradients using pH jumps or ionophores

    • Separate experimental conditions to distinguish ATP-only vs. ATP+proton gradient transport

  • Controls:

    • ATPase-deficient mutants

    • Non-hydrolyzable ATP analogs

    • Ionophores to collapse proton gradients

These reconstitution methods allow for detailed characterization of the energetics and kinetics of lipid transport by MsbA under controlled conditions.

What techniques are most informative for studying MsbA-lipid interactions?

Multiple complementary techniques provide insights into MsbA-lipid interactions:

TechniqueInformation ProvidedAdvantages
X-ray crystallographyHigh-resolution structural information; Binding sites; Conformational states Atomic-level detail; Visualization of binding interfaces
EPR spectroscopyConformational changes; Lipid accessibilityCan be applied in native-like environments
Mass spectrometryBinding stoichiometry; Co-purifying lipidsHigh sensitivity; Can identify specific bound lipids
Fluorescence spectroscopyBinding affinities; Real-time conformational changesCan be applied to reconstituted systems
Molecular dynamics simulationsDynamic interactions; Energy landscapesProvides mechanism insights; Complements experimental data

Combining these approaches allows researchers to build a comprehensive understanding of how MsbA recognizes, binds, and transports various lipid substrates, including structural rearrangements during the transport cycle.

How can labeled lipids be used to quantify MsbA transport activity?

Transport assays using labeled lipids provide quantitative measures of MsbA activity:

  • Fluorescent lipid analogs:

    • NBD-labeled phospholipids for real-time transport monitoring

    • Dithionite quenching assays to distinguish inner vs. outer leaflet populations

    • Concentration-dependent measurements to determine kinetic parameters

  • Radioactive lipids:

    • 3H or 14C-labeled lipids for high-sensitivity detection

    • Back-extraction assays to quantify transported lipids

    • Time-course experiments to determine transport rates

  • Transport conditions to test:

    • ATP dependence: comparing transport rates with ATP vs. non-hydrolyzable analogs

    • Proton gradient dependence: presence/absence of ionophores or pH gradients

    • Different lipid substrates: comparing phospholipids vs. Lipid A transport

  • Data analysis:

    • Initial rate determination

    • Michaelis-Menten kinetics where applicable

    • Comparison of energy requirements across different lipid substrates

These approaches have been successfully employed to demonstrate the lipid-dependent energetics of MsbA transport, establishing that some lipids require both ATP and a proton gradient while others require only ATP .

What structural features distinguish the inward-facing and outward-facing conformations of MsbA?

The transport cycle of MsbA involves significant conformational changes between inward-facing and outward-facing states:

FeatureInward-Facing ConformationOutward-Facing Conformation
Transmembrane portalLarge amplitude opening toward cytoplasm Opening toward periplasm
NBD arrangementSeparatedDimerized with ATP sandwiched between
Lipid accessibilityFrom cytoplasmic leafletFrom periplasmic leaflet
Coupling helicesExtended positionCompact arrangement

The X-ray crystallography studies of MsbA reveal a large amplitude opening in the transmembrane portal in the inward-facing conformation, which is necessary for accommodating bulky lipid substrates like lipid A . The transition between these conformational states, driven by ATP binding and hydrolysis, is the mechanistic basis for vectorial transport of lipids across the membrane.

How do inhibitors of MsbA affect bacterial cell viability?

Inhibition of MsbA has profound consequences for bacterial viability:

  • Direct effects:

    • Disruption of outer membrane biogenesis

    • Accumulation of lipid A in the inner membrane

    • Altered membrane permeability

  • Secondary effects:

    • Increased sensitivity to antibiotics due to compromised drug efflux

    • Altered resistance to host defense mechanisms

    • Impaired bacterial growth and division

  • Potential for combination therapies:

    • MsbA inhibitors could potentiate the effects of existing antibiotics

    • Particularly valuable against multidrug-resistant strains

    • May lower the effective dose of companion antibiotics

The essential nature of MsbA makes it an attractive target for antimicrobial development, particularly against Gram-negative pathogens that are increasingly resistant to current treatment options.

What are the current knowledge gaps in MsbA research?

Despite significant advances, several important questions about MsbA remain unanswered:

  • Precise molecular details of substrate recognition and selectivity

  • Complete understanding of the coupling between ATP hydrolysis and conformational changes

  • Species-specific differences in MsbA function and inhibitor sensitivity

  • Detailed mechanism of how proton gradients contribute to transport of certain lipids

  • Comprehensive mapping of the drug binding sites and their overlap with lipid binding sites

Future research addressing these knowledge gaps will enhance our understanding of this essential bacterial transporter and potentially lead to new therapeutic strategies targeting bacterial membrane biogenesis.

What are the most promising future directions for MsbA research?

Emerging research directions with high potential impact include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.