Recombinant Pseudoalteromonas atlantica Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
nqrE; Patl_0456; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
nqrE
Target Protein Sequence
MEQYLSLFIRSIFLENMALFYFLGMCTFLAVSKKVKTAMGLGVAVIVVLTISVPVNQLVY ANILAPGALGWAGFPDTDLSFLSFLTFIGVIAALVQILEMTLDKFFPALYNALGIFLPLI TVNCAIFGGVAFAVQRDYTFTESIFYGAGSGAGWALAITLLAAVREKLKYADMPEGVRGL GSVFMIAGLMALGFQSFSGVSI
Uniprot No.

Target Background

Function

The Na(+)-translocating NADH-quinone reductase (NQR) complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na(+) ions from the cytoplasm to the periplasm. NqrA through NqrE subunits are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudoalteromonas atlantica and why is its nqrE subunit significant?

Pseudoalteromonas atlantica is a marine bacterium belonging to the genus Pseudoalteromonas, which includes various species distributed in marine environments . The nqrE subunit is a critical component of the Na(+)-translocating NADH-quinone reductase (NQR) complex, which functions in bacterial respiratory chains. This enzyme complex couples the oxidation of NADH to the reduction of quinones while simultaneously translocating sodium ions across the membrane, contributing to energy conservation and homeostasis in these marine bacteria. The significance lies in understanding marine bacterial energy metabolism, adaptation to saline environments, and comparative studies with other bacterial energy-transducing systems.

How does the Na(+)-translocating NADH-quinone reductase differ from the proton-translocating variant?

The Na(+)-translocating NADH-quinone reductase (NQR) fundamentally differs from proton-translocating NDH-1 in its ion specificity and structural organization. While both catalyze electron transfer from NADH to quinone, the Na(+)-NQR specifically translocates sodium ions rather than protons across the membrane . Structurally, bacterial proton-translocating NDH-1 contains a peripheral domain that catalyzes electron transfer through a chain of seven iron-sulfur clusters, including subunits like NuoI that contain [4Fe-4S] clusters (N6a and N6b) . In contrast, Na(+)-NQR utilizes a different set of cofactors (including FAD, FMN, and iron-sulfur clusters) arranged in a distinct architecture. This sodium specificity provides adaptive advantages in high-salt environments where marine bacteria like Pseudoalteromonas atlantica thrive.

What expression systems are commonly used for producing recombinant nqrE?

For the recombinant expression of Pseudoalteromonas atlantica nqrE, researchers typically employ prokaryotic expression systems, with E. coli being the most widely used host. Common expression vectors include pET series vectors with T7 promoter systems for high-level expression. The expression process generally involves:

  • Gene optimization for the host codon usage

  • Incorporation of affinity tags (His6, GST, or MBP) for purification

  • Transformation into expression strains such as BL21(DE3) or C41(DE3)

  • Induction under controlled temperature conditions (often 18-25°C)

  • Expression in media supplemented with appropriate cofactors

For membrane proteins like nqrE, specialized E. coli strains (C41, C43) designed for membrane protein expression may yield better results than standard strains. Additionally, alternative hosts like Pseudoalteromonas species or other marine bacteria might provide more native-like folding environments, though with potentially lower yields.

What are the optimal conditions for purifying recombinant P. atlantica nqrE while maintaining native conformation?

Purification of recombinant P. atlantica nqrE requires careful consideration of its membrane-associated nature. The following methodological approach is recommended:

  • Cell disruption in buffer containing:

    • 50 mM Tris-HCl (pH 7.5-8.0)

    • 300 mM NaCl

    • 5% glycerol

    • Protease inhibitor cocktail

  • Membrane fraction isolation by ultracentrifugation (100,000g, 1h)

  • Solubilization using:

    • 1-2% mild detergent (DDM, LMNG, or C12E8)

    • 20 mM imidazole

    • 300-500 mM NaCl to maintain native Na+-binding sites

  • Affinity chromatography:

    • Ni-NTA for His-tagged constructs

    • Gradient elution with 50-500 mM imidazole

  • Size exclusion chromatography:

    • Superdex 200 column

    • Running buffer containing 0.05% detergent

Critical factors include maintaining a Na+-containing environment throughout purification (typically 300-500 mM NaCl) and using detergents at concentrations above their critical micelle concentration but below levels that might denature the protein. Temperature control (4°C) throughout the procedure is essential to prevent degradation and preserve activity.

How should researchers approach the investigation of electron transfer mechanisms in the recombinant nqrE subunit?

Investigating electron transfer mechanisms in recombinant nqrE requires a multi-faceted approach combining spectroscopic, biochemical, and computational methods:

  • EPR spectroscopy:

    • Identification of paramagnetic species

    • Characterization of iron-sulfur clusters

    • Analysis of radical intermediates during catalysis

  • Site-directed mutagenesis of conserved residues:

    • Mutation of potential electron transfer residues

    • Analysis of mutants similar to those used for NuoI analysis

    • Comparison of wild-type and mutant activities

  • Stopped-flow kinetics:

    • Measurement of electron transfer rates

    • Determination of rate-limiting steps

    • Analysis under varying substrate concentrations

  • Redox potential measurements:

    • Determination of midpoint potentials of cofactors

    • Construction of redox potential maps

    • Correlation with electron transfer efficiency

  • Structural biology approaches:

    • Cryo-EM analysis of the intact NQR complex

    • Molecular docking of substrates and inhibitors

    • Hydrogen-deuterium exchange mass spectrometry for conformational changes

When analyzing EPR data, researchers should note that mutations affecting one cluster might not impact signals from other clusters, as observed in the NDH-1 system where mutations in NuoI did not affect EPR signals from other clusters .

What methodological approaches are recommended for analyzing contradictory data in nqrE functional studies?

When confronting contradictory data in nqrE functional studies, researchers should implement the following structured approach:

  • Data contradiction categorization:

    • Self-contradictory results within a single experimental dataset

    • Pair contradictions between different experimental approaches

    • Conditional contradictions where certain conditions create apparent conflicts

  • Systematic validation process:

    • Replicate experiments under identical conditions

    • Vary one parameter at a time to identify condition-dependent effects

    • Compare methods for possible methodological artifacts

  • Experimental design controls:

    • Include positive and negative controls in all assays

    • Implement internal standards for quantitative measurements

    • Use multiple detection methods for critical measurements

  • Statistical analysis:

    • Apply appropriate statistical tests based on data distribution

    • Perform power analysis to ensure adequate sample sizes

    • Consider Bayesian approaches for contradictory probability distributions

  • Literature reconciliation:

    • Conduct systematic literature review focusing on methodological differences

    • Contact authors of contradictory studies for clarification

    • Perform meta-analysis where sufficient studies exist

Table 1: Common Sources of Contradictions in nqrE Functional Studies

Contradiction SourceExampleResolution Approach
Buffer compositionActivity differences in Tris vs. phosphate buffersSystematic comparison with controlled ionic strength
Detergent effectsVarying activities with different detergentsReconstitution in liposomes of defined composition
Cofactor incorporationIncomplete or variable cofactor loadingQuantitative analysis of cofactor content
Na+ concentrationDifferent activity optima reportedNa+ titration curves under otherwise identical conditions
Redox partner specificityContradictory electron donor preferencesDirect comparison with standardized redox partners
Protein oligomerizationVarying reports of functional unitsCorrelation of activity with oligomeric state analysis

What are the recommended controls for verifying the functional integrity of recombinant nqrE?

To verify the functional integrity of recombinant nqrE, implement the following control experiments:

  • Enzymatic activity controls:

    • Positive control: Well-characterized related enzyme (e.g., NDH-1 from E. coli)

    • Negative control: Heat-denatured nqrE preparation

    • Species comparison: Native enzyme from P. atlantica when available

  • Structural integrity controls:

    • Circular dichroism to verify secondary structure content

    • Thermal shift assays to assess stability

    • Limited proteolysis patterns compared to native enzyme

  • Cofactor incorporation verification:

    • UV-Vis spectroscopy for flavin cofactors

    • Metal analysis (ICP-MS) for iron content

    • Fluorescence spectroscopy for flavin binding

  • Functional coupling controls:

    • Na+ dependence of activity (absent with non-functional coupling)

    • Inhibitor sensitivity profile (e.g., HQNO, Ag+, Zn2+)

    • Reconstitution in proteoliposomes to verify Na+ translocation

  • Heterologous system validation:

    • Complementation of nqr-deficient bacterial strains

    • Comparison of activities in different expression hosts

    • Assessment of post-translational modifications

These controls should be performed systematically, with appropriate replication and statistical analysis to ensure reliability of results.

How should researchers design experiments to study the integration of nqrE into the complete NQR complex?

Studying nqrE integration into the complete NQR complex requires experimental designs addressing assembly, subunit interactions, and functional coordination:

  • Co-expression strategies:

    • Design of polycistronic constructs containing multiple nqr genes

    • Sequential induction systems for ordered complex assembly

    • Dual-tagging approaches for verification of complex formation

  • Interaction mapping:

    • Crosslinking coupled with mass spectrometry

    • FRET analysis with fluorescently-labeled subunits

    • Yeast two-hybrid or bacterial two-hybrid screening

  • Assembly intermediates characterization:

    • Pulse-chase experiments to track assembly kinetics

    • Native PAGE to identify sub-complexes

    • Sucrose gradient separation of assembly intermediates

  • Functional reconstitution:

    • In vitro reconstitution from purified components

    • Activity measurements at each assembly stage

    • Complementation of defined genetic knockouts

  • Structural analysis:

    • Single-particle cryo-EM of complete complex

    • Comparison of structures with and without nqrE

    • Computational modeling of subunit interfaces

The experimental design should include appropriate controls for each step, particularly verification of complete assembly before functional measurements, and comparison to established systems like the bacterial NDH-1 complex .

What statistical approaches are most appropriate for analyzing nqrE activity data from different experimental conditions?

The selection of statistical approaches for nqrE activity data should be guided by experimental design and data characteristics:

  • For comparative activity studies:

    • ANOVA for comparing multiple conditions

    • Tukey's HSD or Bonferroni correction for post-hoc analysis

    • Mixed-effects models for repeated measures designs

  • For enzyme kinetics data:

    • Non-linear regression for fitting to kinetic models

    • F-test for comparing nested models

    • Bootstrap resampling for parameter confidence intervals

  • For stability and binding studies:

    • Hill equation fitting for cooperative binding

    • Scatchard analysis for binding site quantification

    • Thermal shift data analysis using Boltzmann equation

  • For correlation analyses:

    • Pearson correlation for linear relationships

    • Spearman rank correlation for non-parametric data

    • Multiple regression for multi-factor influences

  • For qualitative methodology integration:

    • Mixed-methods analysis approaches

    • Triangulation of qualitative and quantitative data

    • Thematic analysis for pattern identification

Before selecting statistical methods, researchers should verify assumptions such as normality (using Shapiro-Wilk test), homogeneity of variance (using Levene's test), and independence of observations. For complex datasets, consultation with a biostatistician is recommended to ensure appropriate analysis.

How can researchers reconcile contradictory findings between recombinant nqrE and native enzyme studies?

Reconciling contradictory findings between recombinant and native nqrE studies requires systematic investigation of potential sources of variation:

  • Protein structural differences:

    • Post-translational modifications present in native but not recombinant protein

    • Conformational variations due to expression conditions

    • Tag interference with function in recombinant constructs

  • Methodological standardization:

    • Development of standardized activity assays

    • Calibration using common reference materials

    • Direct side-by-side comparison under identical conditions

  • Environmental factors analysis:

    • Effect of ionic strength on activity comparisons

    • Influence of pH and temperature optima shifts

    • Impact of detergent or membrane environment

  • Systematic literature review:

    • Meta-analysis of published kinetic parameters

    • Identification of consistent vs. variable factors

    • Construction of decision trees for contradiction resolution

  • Advanced analytical approaches:

    • Hydrogen-deuterium exchange mass spectrometry for conformational comparison

    • Native mass spectrometry for cofactor and subunit stoichiometry

    • Molecular dynamics simulations to identify condition-dependent conformational states

When reporting reconciled findings, researchers should follow the mixed-method research paradigm , integrating both qualitative observation and quantitative measurement to develop comprehensive explanations for observed differences.

What are the most common pitfalls in recombinant nqrE expression and how can they be addressed?

Recombinant nqrE expression presents several challenges that can be systematically addressed:

  • Protein misfolding and inclusion body formation:

    • Lower expression temperature (16-18°C)

    • Use of solubility tags (MBP, SUMO, Trx)

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

    • Addition of osmolytes (sorbitol, betaine) to expression media

  • Incomplete cofactor incorporation:

    • Supplementation of growth media with precursors (iron, riboflavin)

    • Co-expression with specific assembly factors

    • Optimization of induction timing relative to cell growth phase

    • Anaerobic expression for oxygen-sensitive cofactors

  • Proteolytic degradation:

    • Use of protease-deficient host strains

    • Addition of protease inhibitors during early purification steps

    • Optimization of purification speed and temperature

    • Design of constructs with stabilizing domains

  • Low yield from membrane fractions:

    • Screening of detergents for optimal extraction

    • Use of specialized strains (C41/C43) for membrane protein expression

    • Application of mild solubilization protocols (extended time, lower detergent)

    • Alternative fusion partners specific for membrane proteins

  • Loss of activity during purification:

    • Maintenance of Na+ throughout purification process

    • Addition of stabilizing ligands during purification

    • Minimization of freeze-thaw cycles

    • Optimization of storage conditions (glycerol, reducing agents)

Each troubleshooting approach should be systematically tested and documented, with careful control experiments to verify the specific impact of each intervention.

How should researchers approach the investigation of potential contamination in nqrE preparations?

Investigating contamination in nqrE preparations requires a multi-faceted approach:

  • Protein homogeneity assessment:

    • SDS-PAGE with silver staining (detection limit ~0.1 ng)

    • Western blotting with anti-His or specific antibodies

    • Mass spectrometry for proteomic identification of contaminants

    • Size-exclusion chromatography coupled with multi-angle light scattering

  • Activity contamination analysis:

    • Activity assays with specific inhibitors of potential contaminating enzymes

    • Comparison of activity ratios across different substrates

    • Correlation of specific activity with protein purity measures

    • Heat inactivation profiles compared to known contaminants

  • Nucleic acid contamination:

    • UV spectroscopy (260/280 ratio)

    • Agarose gel electrophoresis with nucleic acid stains

    • Enzymatic treatment (DNase, RNase) followed by activity reassessment

    • Phenol extraction to remove nucleic acids

  • Metal contamination:

    • ICP-MS analysis for metal content

    • EDTA treatment followed by reconstitution

    • Comparison of metal stoichiometry with structural predictions

    • Competition experiments with specific metal chelators

  • Endotoxin contamination (for functional studies):

    • LAL assay for endotoxin quantification

    • Polymyxin B treatment to neutralize endotoxins

    • TLR4 reporter assays to detect functional endotoxin

    • Triton X-114 phase separation for endotoxin removal

Table 2: Contamination Analysis Decision Matrix for nqrE Preparations

ObservationPotential ContaminationVerification MethodResolution Strategy
Multiple bands on SDS-PAGEProteolytic fragments or impuritiesMass spectrometry identificationAdditional purification steps (ion exchange, HIC)
High A260/A280 ratioNucleic acid contaminationAgarose gel electrophoresisBenzonase treatment, additional purification
Activity without added substrateContaminating enzymesSubstrate specificity analysisIncreased washing during affinity purification
Metal content exceeds expected stoichiometryMetal contaminationICP-MS before/after chelationEDTA treatment followed by specific reconstitution
Batch-to-batch activity variationVariable contamination levelsCorrelation analysis with purity metricsStandardization of purification protocol

What emerging technologies show promise for advancing nqrE structure-function studies?

Several emerging technologies offer significant potential for advancing nqrE research:

  • Cryo-electron microscopy advances:

    • High-resolution structural determination of membrane complexes

    • Time-resolved cryo-EM for capturing conformational changes

    • Correlation with functional states during ion translocation

  • Integrative structural biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry for interface mapping

    • Small-angle X-ray scattering for solution conformations

  • Advanced spectroscopic techniques:

    • Pulse EPR for mapping distances between paramagnetic centers

    • Time-resolved infrared spectroscopy for proton/sodium movements

    • Single-molecule FRET for conformational dynamics

  • Genetic and genomic approaches:

    • CRISPR-based genome editing in native Pseudoalteromonas

    • Deep mutational scanning for structure-function relationships

    • Comparative genomics across diverse Na+-translocating bacteria

  • Computational methods:

    • Molecular dynamics simulations of ion translocation

    • Quantum mechanical calculations of electron transfer

    • Machine learning for prediction of functional residues

These technologies should be applied systematically, with careful validation against established biochemical and functional assays to ensure meaningful interpretation of results.

How can comparative studies between P. atlantica nqrE and homologous proteins advance our understanding of Na+ translocation mechanisms?

Comparative studies between P. atlantica nqrE and homologous proteins provide valuable insights through the following approaches:

  • Phylogenetic analysis:

    • Construction of comprehensive phylogenetic trees

    • Identification of conserved residues across diverse species

    • Correlation of sequence differences with environmental adaptations

  • Structural comparisons:

    • Superimposition of structures from different species

    • Identification of conserved structural motifs

    • Analysis of species-specific structural adaptations

  • Functional complementation:

    • Cross-species complementation experiments

    • Chimeric constructs containing domains from different species

    • Site-directed mutagenesis to introduce species-specific residues

  • Environmental adaptation correlations:

    • Comparison of halophilic vs. non-halophilic species

    • Thermophilic vs. mesophilic adaptations in NQR components

    • Marine vs. terrestrial bacterial adaptations

  • Evolutionary analysis:

    • Ancestral sequence reconstruction

    • Analysis of selection pressures on different domains

    • Horizontal gene transfer patterns in NQR complexes

Researchers should incorporate data from diverse Pseudoalteromonas species, such as P. antarctica and P. luteoviolacea , as well as more distantly related systems like the E. coli NDH-1 , to identify both conserved mechanistic principles and species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.