Recombinant Pseudoalteromonas atlantica Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Source

Recombinant Pseudoalteromonas atlantica Protease HtpX is a partial-length, recombinant form of the HtpX protease expressed in heterologous systems for research and industrial use. It belongs to the M48B peptidase family and is annotated as EC 3.4.24.- . The gene htpX (locus Patl_0373) encodes a 290-amino-acid residue protein with a molecular weight of ~35 kDa .

Biochemical Properties

Key characteristics of the recombinant enzyme include:

PropertyDetails
Expression RegionAmino acids 1–290 (partial protein)
Tag TypeDetermined during production (commonly His-tag or GST)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C or -80°C
ActivityZinc-dependent endoprotease; cleaves membrane and soluble substrates
InhibitorsZinc chelators (e.g., EDTA)
SequenceAccession: Uniprot Q15YY4; includes conserved zinc-binding motifs

Enzymatic Mechanism

  • Zinc Dependence: Requires Zn²⁺ for catalytic activity, with self-cleavage observed in the absence of chelators .

  • Substrate Specificity: Degrades casein and membrane proteins (e.g., SecY) through endoproteolytic cleavage .

  • Thermostability: Retains >65% activity at 20–70°C, similar to homologs in Pseudoalteromonas sp. H2 .

  • pH Tolerance: Active across pH 5–10, optimal near neutral conditions .

Role in Protein Quality Control

HtpX collaborates with ATP-dependent proteases (e.g., FtsH) to degrade misfolded membrane proteins under stress conditions . In E. coli, HtpX overexpression accelerates SecY degradation, confirming its role in membrane protein turnover .

Industrial Applications

  • Collagen Hydrolysis: The homolog EH2 from Pseudoalteromonas sp. H2 generates antioxidant peptides from salmon and porcine collagen, with DPPH scavenging rates up to 42.88% and hydroxyl radical scavenging at 61.83% .

  • Biocatalysis: EH2’s stability in surfactants (e.g., SDS, Tween 80) and organic solvents enhances its utility in detergent and food industries .

Antibiotic Resistance

In Stenotrophomonas maltophilia, HtpX and ClpA proteases mitigate aminoglycoside-induced protein stress, reducing susceptibility to kanamycin and gentamicin .

Comparative Analysis

The table below contrasts HtpX with related proteases:

ProteaseSourceMolecular WeightKey Feature
Recombinant HtpXP. atlantica~35 kDaZinc-dependent, membrane-associated
EH2 MetalloproteasePseudoalteromonas sp. H235 kDaBroad pH/temperature stability
FtsHE. coli71 kDaATP-dependent, degrades SecY

Purification and Yield

A purification protocol for the homolog EH2 illustrates scalable production :

StepTotal Protein (mg)Specific Activity (U/mg)Yield (%)
Crude Extract35010.5100
Ammonium Sulfate50.246.363.3
Anion Exchange5.4295.743.4
Size Exclusion2.1475.227.1

Future Directions

  • Biomedical Applications: Potential use in generating bioactive peptides for nutraceuticals or cosmetics .

  • Antibiotic Adjuvants: Targeting HtpX could enhance aminoglycoside efficacy against resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
htpX; Patl_0373; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Target Names
htpX
Target Protein Sequence
MFRILMFLATNIAVMVLISLVFSLFGFQGLLAQNGVDLDLQALLVYSAVIGFSGSIISLL ISKFMAKRSMNVHVLEHPENDTERWLLRTVERQAEQANIGMPEVGIFVHASPNAFATGWN KNNALVAVSTGLLENMTQSEVEAVLAHEISHVANGDMVTMTLIQGVLNTFVVFLSRVIGH VVDRVVFKVERGHGPAFWIVSIISQVILGILASMIVMWFSRYREFRADAGGASIAGRNNM IAALKRLKQNQDAPPMPEEMAAFAISAGKVQKLFSSHPPLDKRIEALQKG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX and what organism does it originate from?

Protease HtpX is a metalloprotease originally derived from the marine bacterium Pseudoalteromonas atlantica strain T6c (ATCC BAA-1087). It belongs to the EC 3.4.24.- enzyme classification and is also known as Heat shock protein HtpX, indicating its potential role in stress response . Pseudoalteromonas is a genus within the class Proteobacteria (gamma subdivision) commonly found in marine environments. Some Pseudoalteromonas strains, particularly pigmented varieties, have demonstrated notable bioactive properties including algicidal effects against harmful algal bloom species . The protease is encoded by the htpX gene, which produces a protein of approximately 290 amino acid residues containing metalloprotease (zincin) catalytic domains .

What are the recommended storage conditions for recombinant Protease HtpX?

For optimal stability and activity maintenance, recombinant Pseudoalteromonas atlantica Protease HtpX should be stored in a Tris-based buffer containing 50% glycerol that has been specifically optimized for this protein. Long-term storage recommendations include maintaining the protein at -20°C, with extended storage preferably at -20°C or -80°C to prevent activity loss . For working solutions, it is advisable to prepare small aliquots to avoid repeated freeze-thaw cycles, which can significantly compromise enzyme activity. These aliquots can be stored at 4°C for up to one week without significant activity loss. Experimental data indicates that the enzyme exhibits good temperature tolerance, maintaining over 90% activity after 8 hours at 50°C, though activity severely decreases after 8 hours at 60°C .

What are the optimal reaction conditions for Protease HtpX activity?

Experimental characterization reveals that Protease HtpX from Pseudoalteromonas atlantica exhibits maximum activity at approximately 45°C, with activity doubling compared to measurements taken at 30°C. The optimal pH for enzymatic activity is pH 7, with the enzyme maintaining relatively high activity within the pH range of 7-9 . When designing experimental protocols, these parameters should be carefully controlled to ensure maximum enzyme efficiency. The enzyme shows good stability when stored in pH 6 buffer for 8 hours, maintaining the highest enzyme activity preservation rate compared to storage under more acidic or alkaline conditions. These properties classify it as a neutral, heat-resistant protease that can function effectively in moderate temperature environments, making it suitable for various research applications requiring these specific conditions .

How does the binding of different metal ions affect the active site of HtpX protease?

The active site and binding pocket characteristics of HtpX protease are significantly influenced by interactions with various metal ions. CASTpFold analysis demonstrates that the binding of Ca²⁺, Zn²⁺, Cl⁻, and K⁺ to the DX-3-htpX protease substantially alters both the three-dimensional structure and active site configurations . Quantitative analysis of these changes reveals notable differences in active pocket dimensions, as shown in the following table:

Protease FormArea (Ų)Volume (ų)Number of Active Sites
HtpX (unbound)557.472837.24141
HtpX-Ca²⁺918.1541378.22138
HtpX-Cl⁻714.286867.36439
HtpX-K⁺925.5441335.23743
HtpX-Zn²⁺811.0231179.127~40*

*Value estimated from partial data

This comparative analysis demonstrates that calcium ion binding produces the largest active pocket volume (1378.221 ų), representing a 64.6% increase over the unbound form. Potassium binding creates the largest surface area (925.544 Ų), a 66.0% increase from the native state. These structural modifications likely contribute to the ion-dependent enzymatic activity variations observed in experimental studies, providing insights into potential mechanisms for regulating protease function through metal ion availability .

How does recombinant expression enhance the activity of HtpX protease?

Recombinant expression of the HtpX protease gene in optimized host systems has been shown to dramatically increase enzymatic activity compared to native sources. When the htpX gene from strain DX-3 was cloned into the pHT43 plasmid and expressed in Bacillus subtilis WB800N using IPTG induction, the resulting recombinant DX-3-htpX protease exhibited significantly enhanced performance metrics . Fermentation in LB medium produced a high activity of 135.68 ± 3.66 U/mL for the recombinant enzyme, representing a remarkable 62-fold increase compared to the native DX-3 protease, which yielded only 2.19 ± 0.28 U/mL under identical conditions .

Furthermore, while the recombinant enzyme maintained the same optimal reaction temperature (45°C) and pH (7.0) as the native form, it demonstrated improved resistance to temperature variations and pH fluctuations. This enhanced stability makes the recombinant version particularly valuable for research applications requiring robust enzymatic performance under variable experimental conditions . The significant activity enhancement underscores the importance of optimized expression systems in maximizing protease yield and function for research applications.

What expression system is recommended for producing recombinant Pseudoalteromonas atlantica Protease HtpX?

For optimal expression of recombinant Pseudoalteromonas atlantica Protease HtpX, a methodological approach using Bacillus subtilis WB800N as the expression host has demonstrated superior results. The recommended protocol involves:

  • Amplification of the htpX gene using PCR with primers containing appropriate restriction sites (e.g., BamHI and SmaI)

  • Cloning the amplified gene into the pHT43 expression vector

  • Transformation into an intermediate host (E. coli DH5α) for plasmid verification

  • Secondary transformation into E. coli BL21 (DE3) to improve transformation efficiency

  • Final electro-transformation into Bacillus subtilis WB800N

  • Selection of positive transformants on LB plates containing appropriate antibiotic resistance (e.g., Cm at 10 μg/mL)

The expression should be induced when cultures reach OD600 ≈ 0.6–0.8 using IPTG at a final concentration of 1 mM. This system has produced significantly higher enzymatic activity (135.68 ± 3.66 U/mL) compared to native sources, while maintaining the optimal reaction temperature of 45°C and pH 7.0 . The B. subtilis WB800N system offers advantages in protein secretion efficiency and reduced proteolytic degradation, making it particularly suitable for HtpX production.

What analytical methods should be employed to characterize the recombinant Protease HtpX?

Comprehensive characterization of recombinant Pseudoalteromonas atlantica Protease HtpX requires multiple analytical approaches:

  • Protein Identification and Structural Analysis:

    • SDS-PAGE for molecular weight confirmation (expected band at approximately 42 kDa)

    • LC-MS/MS analysis for peptide identification and sequence verification

    • InterPro domain analysis to confirm the presence of the peptidase M48 domain (residues 87-289) and metalloprotease catalytic domains

    • Three-dimensional structure prediction using computational tools such as AlphaFold3

    • Active site analysis using CASTpFold to identify binding pockets and metal ion interactions

  • Enzymatic Property Assessment:

    • Temperature optimization studies (30-60°C range) with extended stability testing (8+ hours)

    • pH profiling (pH 6-9 recommended) with stability assessment

    • Metal ion dependency analysis, particularly focusing on Ca²⁺, Zn²⁺, Cl⁻, and K⁺ effects on activity

  • Kinetic Analysis:

    • Determination of specific activity using appropriate substrates

    • Calculation of Km, Vmax, and catalytic efficiency parameters

    • Inhibition studies to characterize regulation mechanisms

All experiments should be conducted in triplicate with results reported as mean values ± standard deviation. Statistical analysis and graphical representation can be performed using software such as Origin 2021 .

How should researchers interpret changes in HtpX protease active site dimensions?

When analyzing structural changes in the HtpX protease active site, researchers should consider both the quantitative dimensions (area and volume) and the qualitative composition of amino acid residues forming the binding pocket. The unbound HtpX protease exhibits a relatively compact binding pocket (area: 557.472 Ų, volume: 837.241 ų) with 41 active site residues including ARG4, LEU7, PHE8, and others . The significant expansion observed upon metal ion binding—particularly with Ca²⁺ (64.6% volume increase) and K⁺ (66.0% area increase)—suggests potential conformational changes that expose additional catalytic residues.

When interpreting these structural modifications, researchers should correlate dimensional changes with alterations in the specific amino acid composition of the active site. For example, when comparing the unbound form to the Ca²⁺-bound state, several residues (including LEU1, LYS3, ALA110, GLU111) become newly exposed in the binding pocket while others from the unbound state are no longer accessible . These compositional shifts likely influence substrate specificity and catalytic efficiency. Therefore, comprehensive interpretation requires analysis of both geometric parameters and the specific amino acid environment of the catalytic site, particularly when troubleshooting unexpected enzymatic behaviors or designing targeted modifications to the protease.

What are common challenges in expressing recombinant Protease HtpX and how can they be addressed?

Several challenges may arise during the expression and purification of recombinant Pseudoalteromonas atlantica Protease HtpX. A methodological approach to troubleshooting includes:

  • Low Expression Yields:

    • Optimize codon usage for the expression host (B. subtilis WB800N)

    • Adjust induction conditions (IPTG concentration, temperature, duration)

    • Consider using stronger promoters or increasing copy number

    • Monitor growth curves to ensure induction occurs at optimal cell density (OD600 ≈ 0.6–0.8)

  • Protein Inactivity:

    • Verify protein folding using circular dichroism or thermal shift assays

    • Ensure proper metal ion availability (particularly Zn²⁺ and Ca²⁺) in the buffer

    • Optimize storage conditions to prevent activity loss (50% glycerol, -20°C)

    • Check for inhibitory compounds in the expression or purification reagents

  • Purification Difficulties:

    • Consider tag-based purification strategies while noting that "tag type will be determined during production process"

    • Implement ion exchange chromatography optimized for the protease's isoelectric point

    • Use size exclusion chromatography as a polishing step

    • Validate purification success using activity assays rather than relying solely on SDS-PAGE

  • Stability Issues:

    • Prevent repeated freeze-thaw cycles by preparing small aliquots

    • Maintain optimal pH (around pH 6-7) for storage solutions

    • Consider adding stabilizing agents like glycerol (50%)

    • For working solutions, store at 4°C for no more than one week

Implementing these strategies systematically can help researchers overcome common challenges and optimize the production of functional recombinant Protease HtpX.

What emerging applications of Pseudoalteromonas atlantica Protease HtpX show the most research promise?

The unique properties of Pseudoalteromonas atlantica Protease HtpX, particularly its thermal stability (maintaining over 90% activity after 8 hours at 50°C) and neutral pH optimum, position it as a valuable tool for several emerging research applications . The enzyme's marine bacterial origin provides distinctive characteristics compared to terrestrial-derived proteases, potentially offering novel substrate specificities and reaction conditions.

Given the algicidal properties observed in some Pseudoalteromonas strains against harmful algal bloom species, investigating the potential role of HtpX protease in these interactions could yield insights into natural bloom control mechanisms . Additionally, the significant enhancement of enzymatic activity achieved through recombinant expression (62-fold increase) suggests opportunities for further optimization through protein engineering approaches .

The well-characterized metal ion interactions, particularly with Ca²⁺ and K⁺, which substantially alter the active site dimensions, provide a foundation for developing conditionally-activated proteases for controlled proteolysis applications in research settings . Future work should focus on determining the complete substrate profile of HtpX, elucidating its natural biological functions in Pseudoalteromonas atlantica, and exploring potential biotechnological applications leveraging its unique properties and marine origin.

How might understanding HtpX structure-function relationships advance protease research broadly?

The detailed structural analysis of HtpX protease, particularly the elucidation of its ion-dependent active site modifications, provides valuable insights that may advance protease research more broadly. The CASTpFold analysis demonstrating how different metal ions (Ca²⁺, Zn²⁺, Cl⁻, K⁺) significantly alter both the dimensions and amino acid composition of the binding pocket offers a model for understanding allosteric regulation in metalloproteases .

The substantial differences observed—from a compact unbound state (837.241 ų) to a significantly expanded Ca²⁺-bound conformation (1378.221 ų)—illustrate how ion binding can serve as a regulatory mechanism for protease activity . This understanding could inform the development of new approaches to control proteolytic activity in experimental systems through manipulation of the ionic environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.