Recombinant Pseudoalteromonas haloplanktis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant Production
Recombinant plsY is typically expressed in E. coli with an N-terminal His-tag for purification. Key specifications include:

ParameterValue
Source OrganismPseudoalteromonas haloplanktis TAC125 (strain TAC 125)
Expression HostE. coli
Protein Length1–203 amino acids (full-length)
Purity>90% (SDS-PAGE analysis)
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
Storage Conditions-20°C/-80°C (avoid repeated freeze-thaw cycles)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional glycerol addition

Functional Role
PlsY operates in the PlsX-PlsY pathway, converting acyl-acyl carrier protein (ACP) to acyl-phosphate via PlsX, followed by acyl transfer to glycerol-3-phosphate. This reaction is essential for initiating membrane phospholipid biosynthesis in bacteria .

Research Applications

Recombinant Protein Production
While P. haloplanktis TAC125 is engineered as a psychrophilic host for challenging proteins , plsY itself is produced in E. coli due to its compatibility with mesophilic expression systems. Recent advances in P. haloplanktis plasmid engineering (e.g., high-copy OriR derivatives) aim to enhance recombinant yield, though plsY production remains E. coli-centric .

Role in Lipid Biosynthesis
PlsY’s activity is pivotal for membrane lipid homeostasis, particularly in cold-adapted bacteria. Its psychrophilic adaptations enable efficient catalysis at low temperatures, a trait under investigation for biotechnological applications .

Comparative Analysis of PlsY Orthologs

OrganismUniprot IDLength (aa)Key Features
P. haloplanktis TAC125Q3IHX2203His-tagged recombinant, glycerol-3-phosphate acyltransferase activity
P. atlanticaQ15X19200Similar catalytic motifs, E. coli-expressed
Streptococcus pneumoniaeFive transmembrane segments, conserved motifs

Future Directions

  1. Cold-Adapted Catalysis: Structural studies to elucidate temperature-dependent conformational changes.

  2. Plasmid Engineering: Potential re-introduction of plsY into P. haloplanktis for dual-host systems (e.g., psychrophilic and mesophilic).

  3. Metabolic Engineering: Leveraging plsY to modulate phospholipid composition in biofilm-forming bacteria .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
plsY; PSHAa2303; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Pseudoalteromonas haloplanktis (strain TAC 125)
Target Names
plsY
Target Protein Sequence
MLATLMFILAYLLGSISSAILVSRLFKLPDPRSNGSNNPGATNVYRLGGALPACLVLIFD VLKGTIPVWGAYFLDLEPLALGLVAVAACLGHMFPLFFGFKGGKAVATAFGSLLPIGLSL AGLLICTWFIMVAITRYSSLAALVAVSLAPLYTWLIKPLYTLPVTFITVLIIFRHRSNIA RLFSGNEPKVGAKKAPTDEKSDI
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.