Recombinant Pseudoalteromonas haloplanktis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Lipoprotein Signal Peptidase (LspA) is a membrane-bound protease responsible for cleaving signal peptides from prolipoproteins during bacterial lipoprotein maturation . In Pseudoalteromonas haloplanktis, a cold-adapted Antarctic bacterium, LspA facilitates efficient protein secretion even at low temperatures, making it valuable for biotechnological applications requiring psychrophilic activity .

  • Catalytic Activity: Cleaves the signal peptide of prolipoproteins after the conserved lipobox motif (typically LxxC) .

  • Temperature Adaptability: Retains enzymatic activity at low temperatures (4–15°C), aligning with P. haloplanktis’s psychrophilic nature .

  • Industrial Relevance: Utilized in metabolic engineering to enhance recombinant protein yields in bacterial hosts by optimizing secretion pathways .

5.1. Protein Expression Optimization

Studies demonstrate that P. haloplanktis strains engineered with inducible plasmids (e.g., pP79) show improved LspA-dependent secretion of recombinant proteins like GFP and mScarlet, even at 0°C . Biofilm-based production systems further enhance solubility and reduce proteolysis compared to planktonic cultures .

5.2. Comparative Advantages

  • Solubility: Cold-adapted expression minimizes protein aggregation, with >85% solubility reported for antibody fragments .

  • Cost Efficiency: Biofilm cultures require lower antibiotic concentrations and carbon sources than traditional methods .

Future Directions

Ongoing research focuses on:

  1. Strain Engineering: Deletion of proteases (e.g., Lon) to enhance LspA stability .

  2. Synthetic Biology: Leveraging P. haloplanktis’s cold-shock promoters for tunable LspA expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
lspA; PSHAa0919; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Pseudoalteromonas haloplanktis (strain TAC 125)
Target Names
lspA
Target Protein Sequence
MSKLAQKSGLVWLWLSLLLLVVDFASKTLVVSSMAYQESINLLPVFSITYVHNYGAAYSF LSDAGGWQRWFLSAIAIAISGLLVWWLKRLPATNKVLCAAYSLVLAGAIGNLYDRIAYGY VIDFIHVFYKNSHFPVFNVADCAICIGAALLLFDAFTGESPKEHKA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its role in bacterial physiology?

Lipoprotein signal peptidase (LspA) is an essential aspartyl protease responsible for cleaving the transmembrane helix signal peptide of lipoproteins as part of the bacterial lipoprotein-processing pathway. This enzyme performs the critical second step in the pathway, following lipidation by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt). LspA's function is integral to bacterial cell envelope maintenance as lipoproteins constitute approximately 2-3% of bacterial genomes and perform diverse functions including signal transduction, transport, stress sensing, cell division, nutrient uptake, and adhesion. Proper processing of these lipoproteins by LspA is essential for bacterial viability, particularly in Gram-negative bacteria, and contributes significantly to bacterial pathogenicity and virulence mechanisms.

Research approaches to studying LspA typically begin with sequence analysis to identify conserved catalytic domains, followed by expression studies to determine localization and functional importance. The enzyme's fundamental biochemical characterization involves substrate specificity assays, determination of optimal reaction conditions, and inhibition studies with compounds like globomycin that mimic the natural substrate.

Why is Pseudoalteromonas haloplanktis TAC125 a valuable model organism for cold-adapted enzyme research?

Pseudoalteromonas haloplanktis TAC125 (PhTAC125) has emerged as an excellent model system for studying cold-adapted enzymes due to its remarkable adaptation to extreme environments. This marine bacterium thrives in Antarctic seawater and has evolved unique biochemical properties that enable functionality at low temperatures. Several characteristics make it particularly valuable for recombinant protein studies:

  • PhTAC125 possesses cold-active enzymes that maintain catalytic efficiency at temperatures where mesophilic homologs are nearly inactive

  • It offers a unique biotechnological potential for processes that require low-temperature conditions

  • The strain has a well-characterized genome with an endogenous megaplasmid (pMEGA) that affects its metabolism

  • It demonstrates enhanced resistance to oxidative stress when cured of the pMEGA plasmid

For researchers, PhTAC125 presents opportunities to study fundamental mechanisms of enzyme cold adaptation and to develop novel expression systems for biotechnologically relevant proteins, including temperature-sensitive therapeutics and industrial enzymes.

What are the structural features and conserved domains of bacterial LspA?

Bacterial LspA enzymes share several highly conserved structural features essential for their function as aspartyl proteases. Based on crystallographic studies of LspA from Pseudomonas aeruginosa and comparative analysis with other bacterial species, the following key features have been identified:

  • A catalytic dyad consisting of two aspartic acid residues that coordinate the proteolytic mechanism

  • Fourteen additional highly conserved residues surrounding the active site that maintain structural integrity and substrate specificity

  • A β-cradle domain that participates in substrate binding

  • A flexible periplasmic helix (PH) that undergoes conformational changes during substrate binding and catalysis

  • Four transmembrane helices that anchor the enzyme in the bacterial membrane

The periplasmic helix demonstrates remarkable conformational dynamics, fluctuating on the nanosecond timescale between open, intermediate, and closed states. In the apo (unbound) state, the dominant conformation is closed, occluding the charged active site from the lipid bilayer. Upon substrate or inhibitor binding, the periplasmic helix adopts more open conformations to accommodate the ligand.

This structural plasticity is critical for LspA's ability to recognize and process diverse lipoprotein substrates, explaining how a single enzyme can accommodate the variety of lipoproteins present in bacterial genomes.

How do the conformational dynamics of LspA affect its catalytic mechanism and inhibitor binding?

The catalytic activity of LspA is intimately linked to its conformational dynamics, which have been elucidated through a combination of molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) studies. LspA exhibits three distinct conformational states that play crucial roles in its function:

  • Closed conformation: The dominant state in apo LspA where the periplasmic helix (PH) is positioned over the active site, occluding the charged catalytic dyad from the lipid bilayer. The distance between the β-cradle and PH is approximately 6.2 Å in this state.

  • Intermediate conformation: The predominant state when bound to the antibiotic globomycin, representing a partially open active site. This conformation may also be relevant for the substrate-bound state.

  • Open conformation: A state where the active site forms a trigonal cavity large enough to accommodate the lipoprotein substrate in the correct orientation for signal peptide cleavage.

These conformational states exist in equilibrium, with their populations shifting based on substrate or inhibitor binding. The nanosecond timescale fluctuations of the periplasmic helix are critical for enzyme function, allowing the active site to alternate between a protected state (closed) and an accessible state (open) for substrate binding.

The antibiotic globomycin achieves its inhibitory effect through molecular mimicry, acting as a noncleavable peptide that sterically blocks the active site. Interestingly, globomycin can adopt multiple binding modes while maintaining similar interactions with the catalytic dyad, demonstrating the remarkable adaptability of the LspA active site.

Understanding these conformational dynamics provides valuable insights for rational drug design targeting LspA, as effective inhibitors must stabilize conformations that prevent substrate access and processing.

What methodologies are most effective for expressing and purifying recombinant P. haloplanktis LspA?

Successful expression and purification of recombinant P. haloplanktis LspA requires specialized approaches due to its membrane-associated nature and cold-adapted properties. Based on established protocols for similar enzymes from P. haloplanktis, the following methodological strategy is recommended:

Expression System Selection:

  • E. coli BL21(DE3) has proven effective for recombinant production of P. haloplanktis proteins, as demonstrated with PhAP protease

  • Expression vectors with T7 promoter systems (such as pET22b) provide controlled induction and good yield

  • Consider C-terminal His-tag fusion for efficient purification while preserving N-terminal signal sequence integrity

Optimized Expression Protocol:

  • Transform expression plasmid into E. coli BL21(DE3)

  • Culture cells at 37°C to mid-log phase (OD600 ~0.6)

  • Reduce temperature to 20-25°C before induction to improve folding of cold-adapted enzymes

  • Induce with low IPTG concentration (0.1-0.5 mM) to prevent inclusion body formation

  • Continue expression at 16-20°C for 16-24 hours to maximize properly folded protein yield

Membrane Protein Extraction:

  • Harvest cells by centrifugation (5,000×g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl

  • Disrupt cells by sonication or French press

  • Isolate membrane fraction by ultracentrifugation (100,000×g, 1 hour, 4°C)

  • Solubilize membrane proteins with gentle detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS at 1-2%)

Purification Strategy:

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Apply a shallow imidazole gradient (20-250 mM) for selective elution

  • Follow with size exclusion chromatography to remove aggregates and heterogeneity

  • Maintain detergent at concentrations above critical micelle concentration throughout purification

  • Verify purity by SDS-PAGE and Western blot analysis

This methodological framework can be adapted based on specific research requirements and has been successfully applied to other membrane proteins from P. haloplanktis.

How does globomycin inhibit LspA at the molecular level and what are the implications for antibiotic development?

Globomycin represents a compelling model for understanding LspA inhibition and developing novel antibiotics. Crystal structure analysis of LspA from Pseudomonas aeruginosa in complex with globomycin at 2.8 Å resolution has revealed the molecular basis for its inhibitory action:

Globomycin employs molecular mimicry to inhibit LspA, functioning as a noncleavable peptide that sterically blocks the active site. The antibiotic stabilizes an intermediate conformation of the enzyme that prevents both substrate binding and signal peptide cleavage.

Molecular dynamics and EPR studies reveal that globomycin can adopt multiple binding modes while maintaining critical interactions with the catalytic dyad. This adaptability allows globomycin to effectively block the active site despite LspA's conformational dynamics.

The inhibitor-bound state exhibits a unique periplasmic helix conformation that differs from both the fully closed (apo) and fully open (substrate-accessible) states. This intermediate state is stabilized by specific interactions between globomycin and conserved residues in the LspA active site.

These findings have significant implications for antibiotic development:

  • The extensive conservation of active site residues suggests that resistance mutations that would prevent antibiotic binding would likely also interfere with normal substrate binding and enzyme function, reducing the likelihood of resistance development.

  • LspA represents an excellent target for antibiotic development because:

    • It is essential in Gram-negative bacteria

    • It is important for virulence in Gram-positive bacteria

    • It has no mammalian homologs

    • Its structural properties may limit antibiotic resistance development

  • Structure-based drug design can leverage the understanding of LspA's conformational dynamics to develop compounds that:

    • Mimic the peptide substrate but resist cleavage

    • Stabilize inactive conformations of the enzyme

    • Form interactions with the highly conserved active site residues

The elucidation of globomycin's inhibitory mechanism provides a valuable template for rational design of next-generation antibiotics targeting the lipoprotein processing pathway.

What are the specific cold-adaptation features of P. haloplanktis LspA compared to mesophilic homologs?

P. haloplanktis LspA, like other cold-adapted enzymes from this psychrophilic organism, exhibits specific structural and biochemical adaptations that enable efficient catalysis at low temperatures. Although the search results don't provide specific data on P. haloplanktis LspA cold adaptation, extrapolating from studies on other cold-adapted enzymes from this organism, the following adaptations are likely present:

Structural Adaptations:

  • Increased flexibility in regions surrounding the active site

  • Reduced number of stabilizing interactions (hydrogen bonds, salt bridges, etc.)

  • Higher proportion of glycine residues, providing enhanced backbone flexibility

  • Fewer proline residues in loops, increasing local mobility

  • Reduced hydrophobic core packing

Biochemical Characteristics:

  • Lower activation energy (Ea) for catalysis

  • Higher catalytic efficiency (kcat/Km) at low temperatures

  • Reduced thermal stability

  • Shift in temperature optimum toward lower temperatures

  • Altered pH profiles compared to mesophilic homologs

These adaptations represent an evolutionary trade-off between structural stability and catalytic efficiency at low temperatures. The enhanced flexibility particularly in the periplasmic helix and active site regions would enable substrate binding and catalysis to proceed efficiently in the cold marine environment where P. haloplanktis naturally thrives.

For experimental characterization of these cold-adaptation features, researchers typically employ comparative analysis between the psychrophilic enzyme and mesophilic/thermophilic homologs, examining parameters such as:

  • Temperature-dependent activity profiles

  • Thermal denaturation measurements

  • Conformational dynamics using techniques like hydrogen-deuterium exchange

  • Molecular dynamics simulations at different temperatures

  • Circular dichroism spectroscopy to assess secondary structure stability

What methods are most effective for studying LspA enzyme kinetics and activity?

Studying the enzyme kinetics and activity of LspA presents unique challenges due to its membrane-embedded nature and the complexity of its natural lipoprotein substrates. Based on established methodologies for similar enzymes, the following approaches are recommended:

Substrate Selection and Preparation:

  • Natural prolipoprotein substrates: Express and purify specific bacterial prolipoproteins with intact signal sequences

  • Synthetic peptide substrates: Design peptides mimicking the cleavage site of natural substrates

  • Fluorogenic substrates: Develop custom peptides with fluorescence resonance energy transfer (FRET) pairs flanking the cleavage site

Activity Assay Methods:

Assay TypeMethodologyAdvantagesLimitations
HPLC-basedMonitor substrate disappearance and product formation using reversed-phase HPLCDirect measurement of cleavage, quantitativeLow throughput, requires specialized equipment
Fluorescence-basedUse FRET peptides where cleavage increases fluorescenceHigh sensitivity, real-time monitoring, suitable for kinetic studiesRequires custom substrate synthesis
Mass spectrometryIdentify cleavage products by exact massPrecise identification of cleavage site, no substrate modification neededLower throughput, requires specialized equipment
ColorimetricUse chromogenic substrates (e.g., p-nitroanilide derivatives)Simple, adaptable to plate reader formatMay have lower sensitivity

Kinetic Parameter Determination:

  • Establish linear range of enzyme activity

  • Perform substrate concentration series (typically 0.1-10× Km)

  • Calculate Km, Vmax, and kcat using appropriate enzyme kinetics models

  • Analyze temperature dependence (10-40°C range) to determine activation energy

  • Evaluate pH effects on activity and stability

Inhibition Studies:

  • Pre-incubate enzyme with potential inhibitors (e.g., globomycin)

  • Determine IC50 values through dose-response curves

  • Characterize inhibition mechanism (competitive, non-competitive, uncompetitive)

  • Analyze structure-activity relationships for inhibitor series

For membrane proteins like LspA, it's essential to maintain appropriate detergent conditions throughout all assays to ensure enzyme stability and native-like conformation. Detergent screening should be performed to identify conditions that maintain enzyme activity while allowing proper substrate access.

Similar methodology has been successfully applied to other proteases from P. haloplanktis, such as PhAP, where activity was measured using both the macromolecular substrate azocasein and specific peptide-p-nitroanilide substrates, with absorbance monitoring at appropriate wavelengths.

How can researchers optimize heterologous expression systems for P. haloplanktis LspA to maintain native structure and activity?

Optimizing heterologous expression of P. haloplanktis LspA requires careful consideration of its psychrophilic origin and membrane-associated nature. The following strategies address common challenges:

Expression Host Selection:

  • E. coli BL21(DE3) remains the primary choice due to its suppressed proteolytic activity and established protocols for membrane protein expression

  • Pseudoalteromonas species expression systems can be considered for authentic post-translational processing

  • Cell-free expression systems offer advantages for toxic membrane proteins

Vector Design Considerations:

  • Incorporate fusion tags that facilitate both expression and purification

  • Consider inducible promoters with fine control over expression levels

  • Evaluate signal sequence modifications to ensure proper membrane targeting

  • Design constructs with and without native signal sequences to assess functional differences

Expression Condition Optimization:

  • Reduce cultivation temperature (16-20°C) during expression phase

  • Implement autoinduction media to achieve gradual protein production

  • Supplement growth media with glycylbetaine and other osmolytes that stabilize psychrophilic proteins

  • Test various induction conditions (IPTG concentration, induction timing, duration)

Membrane Protein Stabilization:

  • Screen detergent panels for optimal extraction and stability

  • Consider nanodiscs or lipid cubic phase for maintaining native-like membrane environment

  • Implement thermofluor assays to identify buffer conditions enhancing stability

  • Evaluate addition of specific lipids that may be required for proper folding and activity

When troubleshooting expression problems, a systematic approach is recommended:

  • For poor expression: modify the N-terminal sequence, adjust rare codon usage, or test different fusion partners

  • For inclusion body formation: reduce expression temperature, decrease inducer concentration, or co-express with chaperones

  • For improper membrane insertion: verify signal sequence compatibility with expression host or consider membrane-targeting fusion partners

Implementing these strategies has proven successful for other cold-adapted enzymes from P. haloplanktis and should be applicable to LspA expression.

What approaches can resolve contradictory findings about LspA conformational states and dynamics?

Research on LspA has revealed complex conformational dynamics that sometimes lead to apparently contradictory findings across different experimental techniques. Resolving these contradictions requires integrating multiple methodological approaches:

Integrated Methodology Approach:

  • Hybrid experimental design combining molecular dynamics (MD) simulations with electron paramagnetic resonance (EPR) has proven particularly effective for identifying protein conformations not observed in crystal structures alone. This approach successfully revealed that LspA samples three distinct conformations (closed, intermediate, and open) across all functional states.

  • Time-resolved techniques can reconcile contradictions by capturing transient states:

    • Temperature-jump coupled with spectroscopic methods

    • Single-molecule FRET to track conformational distributions

    • Hydrogen-deuterium exchange mass spectrometry to map dynamics

  • Correlation of structure with function through:

    • Site-directed mutagenesis of residues involved in conformational changes

    • Activity assays under conditions that stabilize different conformations

    • Binding studies with substrate analogs and inhibitors

  • Reconstitution in native-like environments:

    • Comparison of detergent-solubilized versus membrane-embedded states

    • Nanodiscs with varied lipid compositions to assess membrane effects

    • Crystallization with and without binding partners

The conformational analysis of LspA demonstrates that apparent contradictions often reflect the sampling of different states within an equilibrium ensemble. For example, the dominant conformation in the apo state is the most closed, occluding the active site from the lipid bilayer, while the antibiotic-bound state shows multiple conformations with the periplasmic helix in more open positions.

Research has shown that the conformational plasticity of LspA is essential for its function, as it must accommodate diverse lipoprotein substrates while maintaining the specificity required for proper signal peptide cleavage. The flexible and adaptable active site explains LspA's ability to process various substrates despite the high conservation of catalytic residues.

When confronted with contradictory findings, researchers should consider that different experimental conditions may stabilize different conformational states, and that the native function of LspA likely depends on the dynamic equilibrium between these states rather than on a single "correct" conformation.

How can researchers develop new inhibitors of P. haloplanktis LspA for potential antibiotic applications?

Developing novel inhibitors of P. haloplanktis LspA represents a promising avenue for antibiotic discovery, particularly given the essential nature of this enzyme in bacterial physiology and its absence in mammalian cells. The following research pipeline outlines a comprehensive approach:

1. Target Validation and Characterization:

  • Confirm essentiality of LspA in P. haloplanktis through genetic approaches

  • Determine enzyme kinetic parameters and substrate specificity

  • Elucidate the three-dimensional structure through X-ray crystallography or cryo-EM

  • Map conformational dynamics using techniques described in previous sections

2. Screening Strategy Design:

Screening ApproachMethodologyAdvantagesConsiderations
Structure-based virtual screeningMolecular docking against known LspA structuresCost-effective initial filtering, can screen millions of compoundsDepends on accuracy of structural models
Fragment-based screeningNMR or X-ray crystallography to identify binding fragmentsIdentifies novel chemical scaffolds with high ligand efficiencyRequires specialized equipment, lower initial potency
Natural product screeningTesting known antimicrobials and derivatives (e.g., globomycin analogs)Builds on established bioactive scaffoldsMay face resistance mechanisms
High-throughput biochemical assaysFluorescence-based assays using synthetic substratesDirect measure of inhibitory activityRequires robust, validated assay system

3. Rational Design Principles Based on Known Inhibitors:

  • Leverage the understanding that globomycin inhibits by acting as a noncleavable peptide that sterically blocks the active site

  • Design compounds that stabilize the intermediate conformation observed in globomycin-bound structures

  • Target the highly conserved catalytic dyad and surrounding residues to minimize resistance development

  • Incorporate structural features that exploit the enzyme's conformational dynamics

4. Hit-to-Lead Optimization Process:

  • Establish structure-activity relationships through systematic modification of promising scaffolds

  • Optimize for:

    • Potency against P. haloplanktis LspA and homologs from pathogenic bacteria

    • Selectivity over other aspartyl proteases

    • Physicochemical properties supporting membrane penetration

    • Stability in biological systems

  • Use iterative cycles of computational design, synthesis, and testing

5. Preclinical Evaluation Criteria:

  • Determine spectrum of activity against various bacterial species

  • Assess cytotoxicity in mammalian cell lines

  • Evaluate pharmacokinetic properties

  • Investigate resistance development frequency and mechanisms

  • Test efficacy in relevant infection models

This comprehensive approach builds upon the successful characterization of LspA inhibition by globomycin, which has revealed that targeting this enzyme may present a high barrier to resistance development due to the essential nature of the conserved active site residues in substrate processing.

What are the critical factors in designing experiments to study the temperature adaptation of P. haloplanktis LspA?

Studying temperature adaptation in P. haloplanktis LspA requires carefully designed experiments that can reveal the molecular basis for cold activity while maintaining the enzyme's structural integrity. Critical experimental design factors include:

Temperature Range Selection:

  • Primary characterization should span 0-30°C to capture the psychrophilic activity profile

  • Include negative controls at temperatures below freezing (with cryoprotectants) to establish baseline

  • Perform comparative analysis with mesophilic homologs (e.g., from E. coli) across 10-45°C

  • Conduct thermal inactivation studies to determine stability thresholds

Activity Measurement Parameters:

  • Steady-state kinetics: Determine Km, kcat, and catalytic efficiency (kcat/Km) at different temperatures

  • Activation parameters: Calculate activation energy (Ea), enthalpy (ΔH‡), and entropy (ΔS‡) of activation

  • Temperature optima: Identify optimal temperature for activity and compare with growth temperature

  • Thermodynamic stability: Measure unfolding/inactivation temperatures and associated energy changes

Structural Analysis Approaches:

  • Comparative crystallography: Solve structures at multiple temperatures if possible

  • Temperature-dependent CD spectroscopy: Monitor secondary structure changes during thermal transitions

  • Hydrogen-deuterium exchange MS: Map regions with enhanced flexibility at low temperatures

  • MD simulations: Simulate enzyme behavior across temperature range to identify critical motions

Targeted Mutagenesis Strategy:
Design mutations that test specific hypotheses about cold adaptation mechanisms:

  • Introduce rigidifying mutations (e.g., glycine to proline) in flexible regions

  • Modify surface charged residue patterns to alter solvent interactions

  • Strengthen/weaken internal salt bridges or hydrogen bond networks

  • Create chimeric enzymes with mesophilic homologs to identify critical domains

Buffer System Considerations:

  • Use buffers with minimal temperature-dependent pH changes

  • Account for temperature effects on substrate solubility and enzyme-substrate affinity

  • Include appropriate stabilizers for membrane protein studies

  • Control for solvent viscosity effects at different temperatures

By systematically addressing these factors, researchers can generate comprehensive datasets that reveal the molecular adaptations enabling P. haloplanktis LspA to function efficiently in cold environments. This information extends beyond basic characterization to inform potential biotechnological applications where low-temperature enzymatic activity is desirable.

What emerging technologies could advance our understanding of P. haloplanktis LspA structure-function relationships?

Several cutting-edge technologies are poised to revolutionize our understanding of P. haloplanktis LspA structure-function relationships over the next decade:

Cryo-Electron Microscopy Advances:

  • Single-particle cryo-EM for membrane protein structure determination without crystallization

  • Time-resolved cryo-EM to capture conformational intermediates during catalysis

  • In situ structural studies within native-like membrane environments

Integrative Structural Biology Approaches:

  • Combining complementary techniques (X-ray crystallography, NMR, SAXS, cryo-EM) for comprehensive structural models

  • Integrating experimental data with computational predictions using hybrid modeling

  • Cross-linking mass spectrometry to map dynamic protein-protein interactions within the lipoprotein processing pathway

Advanced Computational Methods:

  • Enhanced sampling molecular dynamics to access longer timescales relevant to enzyme function

  • Machine learning approaches for predicting cold-adaptation features from sequence data

  • Quantum mechanics/molecular mechanics simulations for detailed catalytic mechanism elucidation

Next-Generation Functional Genomics:

  • CRISPR-Cas9 engineering of P. haloplanktis for precise genome manipulation

  • Deep mutational scanning to comprehensively map sequence-function relationships

  • Transcriptomics and proteomics under various temperature conditions to understand system-level adaptations

Single-Molecule Technologies:

  • Single-molecule FRET to track conformational dynamics in real-time

  • Optical tweezers or atomic force microscopy to measure mechanical properties of enzyme-substrate interactions

  • Nanopore-based approaches for monitoring individual catalytic events

Synthetic Biology and Directed Evolution:

  • Cell-free expression systems optimized for cold-adapted membrane proteins

  • Directed evolution platforms to enhance desired properties or to explore evolutionary trajectories

  • Designer cell systems with orthogonal lipoprotein processing pathways

These emerging technologies will enable researchers to address fundamental questions about P. haloplanktis LspA that have remained elusive with conventional approaches, particularly regarding:

  • The complete catalytic cycle in a native-like environment

  • Detailed conformational landscape across temperature ranges

  • Precise molecular basis for cold adaptation

  • Structure-guided design of selective inhibitors

Integrating these approaches within a comprehensive research program will accelerate our understanding of this scientifically and medically important enzyme system.

How might comparative studies of LspA across psychrophilic, mesophilic, and thermophilic bacteria inform evolutionary adaptation mechanisms?

Comparative studies of LspA across the thermal spectrum of bacterial adaptation offer unique insights into evolutionary mechanisms and structure-function relationships. A comprehensive research framework includes:

Phylogenetic Analysis Framework:

  • Construct robust phylogenetic trees of LspA homologs across diverse bacterial phyla

  • Map thermal adaptation (psychrophilic, mesophilic, thermophilic) onto phylogenetic trees

  • Identify instances of convergent evolution toward similar thermal niches

  • Analyze selective pressure on different regions of LspA sequence using dN/dS ratios

Sequence-Structure-Function Correlations:

  • Compare amino acid compositions across thermal adaptations, focusing on:

    • Charged vs. hydrophobic residue distribution

    • Proline and glycine content and positioning

    • Cysteine content and disulfide bond formation potential

  • Identify temperature-specific sequence motifs or signatures

  • Correlate sequence variations with structural elements involved in conformational dynamics

  • Map conservation patterns of catalytic residues versus adaptive surface residues

Biochemical Adaptation Signatures:

ParameterPsychrophilic LspA (e.g., P. haloplanktis)Mesophilic LspAThermophilic LspAEvolutionary Implication
Catalytic efficiency (kcat/Km)Higher at low temperaturesModerate at moderate temperaturesLower at moderate temperatures, higher at high temperaturesTrade-off between activity and stability
Activation energy (Ea)LowerIntermediateHigherAdaptation of transition state stabilization
ThermostabilityLowerIntermediateHigherInverse relationship between flexibility and stability
Conformational dynamicsEnhanced flexibility, especially in loops and active siteBalanced dynamicsRestricted mobility except at high temperaturesModulation of dynamic properties for catalysis at target temperature

Experimental Validation Approaches:

  • Reciprocal mutagenesis to introduce thermal adaptation features across homologs

  • Ancestral sequence reconstruction to infer evolutionary trajectories

  • Laboratory evolution experiments under shifting thermal regimes

  • Hybrid enzymes combining domains from different thermal adaptations

Such comparative studies would reveal whether cold adaptation in P. haloplanktis LspA follows universal principles or represents unique evolutionary solutions. Understanding these adaptation mechanisms has broader implications for:

  • Predicting protein behavior under changing environmental conditions

  • Rational design of enzymes with desired thermal properties

  • Understanding bacterial adaptation to climate change

  • Developing targeted antimicrobials with specific thermal activity profiles

The knowledge gained from these studies extends beyond LspA to inform our understanding of protein evolution and adaptation mechanisms across diverse enzyme families.

How can integrated knowledge of P. haloplanktis LspA advance both basic science and therapeutic development?

The integrated study of Pseudoalteromonas haloplanktis LspA represents a uniquely valuable research area that bridges fundamental biological questions with practical applications. The significance of this research spans multiple domains:

From a basic science perspective, P. haloplanktis LspA serves as an excellent model system for understanding:

  • Molecular mechanisms of enzymatic cold adaptation

  • Structure-function relationships in membrane-associated aspartyl proteases

  • Conformational dynamics and their role in enzyme catalysis

  • Evolutionary processes that shape bacterial adaptation to extreme environments

The complex conformational dynamics of LspA, with its fluctuating periplasmic helix and multiple functional states, provides insights into how enzymes balance flexibility and specificity. The discovery that LspA samples closed, intermediate, and open conformations demonstrates the importance of protein dynamics in biological function beyond static structural snapshots.

From a therapeutic development standpoint, P. haloplanktis LspA research contributes to:

  • Novel antibiotic discovery targeting an essential bacterial pathway

  • Rational design strategies based on detailed structural and mechanistic understanding

  • Approaches to minimize resistance development by targeting highly conserved sites

  • Cold-adapted enzyme applications in biotechnology and biocatalysis

The identification of LspA as an aspartyl peptidase and the elucidation of globomycin's inhibitory mechanism through molecular mimicry provide a solid foundation for structure-based drug design. The high conservation of active site residues suggests that resistance mutations would likely compromise enzyme function, making LspA a particularly promising antibiotic target.

Moving forward, integrating computational approaches with structural biology, biochemistry, and microbiology will accelerate both fundamental discoveries and applied research. Cross-disciplinary collaboration between researchers studying cold adaptation, membrane protein biology, bacterial physiology, and drug discovery will be essential to fully realize the potential of P. haloplanktis LspA research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.