Recombinant Pseudoalteromonas haloplanktis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Membrane protein insertase YidC is a protein crucial for the insertion and folding of newly synthesized proteins into lipid membranes . It is essential for cell viability and is found in all kingdoms of life . YidC can function with the SecYEG pathway, which inserts peptides into the membrane through the Signal Recognition Particle (SRP) mechanism, or independently of the Sec pathway to fold and insert proteins .

Synonyms

  • yidC

  • PSHAa3022

  • Membrane protein insertase YidC

  • Foldase YidC

  • Membrane integrase YidC

  • Membrane protein YidC

Source

Recombinant Pseudoalteromonas haloplanktis Membrane protein insertase YidC (YidC) is expressed in vitro using an E. coli expression system.

Function

YidC is essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It is involved in the integration of membrane proteins, both dependent and independent of the Sec translocase complex, as well as certain lipoproteins, and facilitates the folding of multi-spanning membrane proteins.

Conformational Dynamics

YidC undergoes significant conformational changes during the insertion of proteins into the membrane . The transmembrane (TM) region of YidC is crucial for membrane protein insertion into the lipid bilayer . During the insertion process, YidC experiences a gradual conformational shift, adjusting to the incoming peptide .

Mechanism of Insertion

The incoming protein first interacts with the cytoplasmic loops and gradually moves into the hydrophilic groove located in the transmembrane region, forming a salt bridge with R72 . The protein then migrates towards the periplasmic side of the membrane, assisted by hydrophobic forces .

Key Findings

  • YidC facilitates the insertion of newly synthesized proteins into lipid membranes .

  • YidC can function with the SecYEG pathway or independently of it .

  • The transmembrane region of YidC is crucial for membrane protein insertion .

  • YidC undergoes significant conformational changes during the insertion process .

  • The incoming protein interacts with cytoplasmic loops and gradually moves into the hydrophilic groove .

Molecular Details

FeatureDescription
SpeciesPseudoalteromonas haloplanktis (strain TAC 125)
Protein LengthFull length protein
Expression Region1-544
UniProt No.Q3IK55
AA SequenceMESQRTFLFIGLMLVSFLLFQEWNTDYNTPKADPSATTQTLNPTSSESEDYVPTSSDSAL PASATLAKRSVIEITTDVFKVKIDTRGGDIVETYLLQYEETKGSETPYMLLGEFDGKQYF SQSGLIGLNGPDASAQGRPTYHVEQKSYTLTGDELRVPLQFTDSNGVNFTKTYVFKKGQY DVALEYTINNTTSTPLQVQLYTQVKRTVQDKGSMVDQNYLGAAYGTDDDPYEKYSFSDMA DKNLNKITLGGYVAFIQHYFVSAWVPMQDQSNTLYSLITKSNAAIIGVKDEAVNIQAGSE QTLTATYYMGPKESDVLEAIHPDLDLTVDYGWLWFISQPLFVLLKWLHSILGNWGVAIIA ITIIVKSLMYPLTKAQYTSMAKMRALQPKMAALKEKFGDDRQKFGQATMEMYKKEKVNPM GGCFPILLQMPIFLALFYVFLESTELRHAEFIFWLTDLSAKDPYYVLPILFGASMFITQK LQPMTVTDPMQQKMMTFMPVIFSVFFLWFPSGLVLYWLVSNLISIVQMLIIYRGMEKKGI KVRG
Subcellular LocationCell inner membrane; Multi-pass membrane protein
Protein FamiliesOXA1/ALB3/YidC family, Type 1 subfamily
Database LinksKEGG: pha:PSHAa3022, STRING: 326442.PSHAa3022
Storage ConditionStore at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Buffer Before LyophilizationTris/PBS-based buffer, 6% Trehalose

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and an additional fee is agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; PSHAa3022; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Pseudoalteromonas haloplanktis (strain TAC 125)
Target Names
yidC
Target Protein Sequence
MESQRTFLFIGLMLVSFLLFQEWNTDYNTPKADPSATTQTLNPTSSESEDYVPTSSDSAL PASATLAKRSVIEITTDVFKVKIDTRGGDIVETYLLQYEETKGSETPYMLLGEFDGKQYF SQSGLIGLNGPDASAQGRPTYHVEQKSYTLTGDELRVPLQFTDSNGVNFTKTYVFKKGQY DVALEYTINNTTSTPLQVQLYTQVKRTVQDKGSMVDQNYLGAAYGTDDDPYEKYSFSDMA DKNLNKITLGGYVAFIQHYFVSAWVPMQDQSNTLYSLITKSNAAIIGVKDEAVNIQAGSE QTLTATYYMGPKESDVLEAIHPDLDLTVDYGWLWFISQPLFVLLKWLHSILGNWGVAIIA ITIIVKSLMYPLTKAQYTSMAKMRALQPKMAALKEKFGDDRQKFGQATMEMYKKEKVNPM GGCFPILLQMPIFLALFYVFLESTELRHAEFIFWLTDLSAKDPYYVLPILFGASMFITQK LQPMTVTDPMQQKMMTFMPVIFSVFFLWFPSGLVLYWLVSNLISIVQMLIIYRGMEKKGI KVRG
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of YidC in bacterial cells?

YidC functions as a membrane insertase that facilitates the integration of newly synthesized membrane proteins into the lipid bilayer. It plays a critical role in both Sec-dependent and Sec-independent membrane protein insertion pathways. In the Sec-dependent pathway, YidC associates with transmembrane segments of nascent proteins as they exit laterally from the Sec translocon, assisting in their proper folding and assembly in the membrane. For Sec-independent substrates, YidC can function autonomously to catalyze the insertion of certain membrane proteins directly into the lipid bilayer . YidC is particularly important for the insertion of small, single-spanning membrane proteins like the Pf3 coat protein, which has been extensively used as a model substrate in YidC studies .

How is YidC structurally organized in bacterial membranes?

YidC is embedded in the bacterial inner membrane with a characteristic structure consisting of multiple transmembrane helices. The protein contains a large periplasmic domain between its first two transmembrane regions, which is recognized by peptide-specific antibodies and produces a protease-resistant fragment of approximately 42 kDa during proteolytic analysis . YidC forms a hydrophilic groove that is open to the cytosol and penetrates partway into the membrane. This groove likely creates a favorable environment for the membrane insertion of hydrophilic segments of substrate proteins by locally disturbing and thinning the membrane . The arrangement of YidC's transmembrane helices creates a hairpin-interrupted three-TMH (transmembrane helix) motif that is evolutionarily significant .

What experimental systems are commonly used to study YidC function?

Several experimental systems have been developed to study YidC function:

  • In vivo depletion studies: Researchers create conditional YidC depletion strains to observe the effects on membrane protein insertion and cell viability .

  • Reconstituted proteoliposome systems: Purified YidC is incorporated into liposomes to study its activity in a defined environment. This approach allows researchers to demonstrate that YidC alone is sufficient for the insertion of Sec-independent proteins like Pf3 coat protein .

  • Crosslinking assays: These techniques identify the proximity of YidC to nascent membrane proteins during the insertion process, revealing the timing and nature of these interactions .

  • Inverted inner membrane vesicles (INV): These provide a native-like environment for studying membrane protein insertion processes .

  • Molecular dynamics simulations: Both equilibrium and non-equilibrium simulations help investigate the conformational dynamics of YidC during membrane protein insertion .

How can YidC be reconstituted into proteoliposomes for functional studies?

Reconstitution of YidC into proteoliposomes involves several critical steps:

  • Protein purification: Express YidC with an affinity tag (commonly His-tag) in a suitable expression system such as E. coli, followed by detergent-based extraction from membranes and affinity purification .

  • Liposome preparation: Prepare liposomes using phospholipids that mimic the native bacterial membrane composition. Typically, a mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin is used.

  • Reconstitution process: Mix purified YidC with preformed liposomes in the presence of detergent, followed by controlled detergent removal using methods such as dialysis, gel filtration, or addition of polystyrene beads .

  • Verification of orientation: The orientation of YidC in proteoliposomes can be verified using protease protection assays. In properly reconstituted systems, the periplasmic domain of YidC should be inside the liposomes, producing a characteristic 42 kDa protease-resistant fragment when treated with trypsin .

  • Energization: For functional studies requiring a membrane potential, proteoliposomes can be energized using potassium/valinomycin systems or other methods to establish a proton gradient .

This reconstitution approach has been successfully used to demonstrate that YidC alone is sufficient for the membrane insertion of the Pf3 coat protein, with insertion kinetics showing that approximately 50 YidC molecules per liposome provide efficient insertion activity .

What are the current models for the mechanism of YidC-mediated membrane protein insertion?

Current models for YidC-mediated membrane protein insertion include:

  • Hydrophilic groove model: YidC contains a hydrophilic groove that is open to the cytosol and penetrates partially into the membrane. This groove likely creates a favorable environment for the insertion of hydrophilic segments of substrate proteins by exposing hydrophilic groups to the hydrophobic membrane, which distorts and thins the membrane in the vicinity .

  • Membrane thinning mechanism: Biophysical studies and molecular dynamics simulations suggest that YidC's exposure of hydrophilic groups to the hydrophobic membrane causes local distortion and thinning, lowering the energetic barrier for translocation of charged regions across the membrane .

  • Half-channel concept: YidC has been conceptualized as a "half-channel" that could form a near-complete channel through antiparallel homodimerization, similar to what has been observed in ERAD (ER-associated degradation) components like Hrd1 and Der1 .

  • Substrate-specific insertion pathways: Different substrates may engage YidC through distinct mechanisms. For example, some proteins with extended hydrophobic regions can insert independently of YidC but have their insertion accelerated by its presence, suggesting a catalytic rather than essential role in some cases .

How do molecular dynamics simulations contribute to understanding YidC function?

Molecular dynamics (MD) simulations provide valuable insights into the conformational dynamics of YidC during membrane protein insertion:

  • Equilibrium simulations: These simulations reveal the stable conformational states of YidC in a membrane environment and help identify structural elements important for function .

  • Non-equilibrium simulations: Techniques such as targeted MD (TMD) can be used to simulate the process of substrate protein transfer across the membrane. For example, TMD has been used to study the transition of the Pf3 coat protein from a cytoplasmic-facing position to a periplasmic location .

  • Combined approaches: The combination of equilibrium and non-equilibrium MD simulations has proven effective for investigating biological challenges related to membrane protein insertion .

  • Collective variable analysis: Using RMSD (Root Mean Square Deviation) as a collective variable in TMD simulations helps track the conformational changes of substrate proteins during the insertion process .

  • Membrane distortion analysis: MD simulations can quantify how YidC distorts the surrounding lipid bilayer, providing mechanical insights into how it lowers the energy barrier for translocation .

These computational approaches complement experimental methods and provide atomic-level details of insertion mechanisms that are difficult to capture experimentally.

What is the evolutionary relationship between YidC and the Sec translocase?

Recent evolutionary analysis has revealed surprising structural similarities between YidC and SecY, suggesting a unified evolutionary origin:

  • Structural homology: The hairpin-interrupted three-TMH motif of YidC is strikingly similar to the consensus proto-SecY elements, with each consensus helix from the YidC family matching to a consensus helix from proto-SecY with the same connectivity .

  • Functional parallels: Both SecY and YidC facilitate the diffusion of hydrophilic protein segments across the hydrophobic membrane by burying hydrophilic groups inside the membrane .

  • Structural-functional transformation hypothesis: Key structural features of YidC are recognizable in SecY and match with similar functional roles. For example, the point where H4 and H5 meet in YidC forms the hydrophobic end of the hydrophilic groove, while the corresponding region in SecY forms the pore ring near the center of the membrane .

  • Half-channel to full-channel evolution: YidC can be considered a half-channel that could have evolved into a more complete translocation channel through duplication and reconfiguration events, eventually leading to the SecY structure with its continuous hydrophilic pore across the membrane .

This evolutionary relationship suggests that studying YidC can provide insights into the fundamental mechanisms of membrane protein insertion that have been conserved throughout bacterial evolution.

How does membrane potential affect YidC-mediated protein insertion?

The membrane potential (ΔΨ) plays a significant role in YidC-mediated membrane protein insertion:

  • Insertion efficiency: The Pf3 coat protein has been shown to insert into inverted inner membrane vesicles with the help of the membrane potential . In reconstituted YidC proteoliposomes, a slightly lower amount of Pf3 coat protein was inserted in the absence of membrane potential compared to energized proteoliposomes .

  • Charge distribution effects: The membrane potential likely helps overcome the energy barrier for translocation of charged residues across the membrane. This is particularly important for proteins following the "positive-inside rule," where positively charged residues tend to remain on the cytoplasmic side of the membrane.

  • Substrate-dependent requirements: The dependence on membrane potential varies among YidC substrates. Some proteins with extended hydrophobic regions can insert independently of both YidC and membrane potential, while others strictly require both factors .

  • Mechanism of action: The membrane potential may work synergistically with YidC's membrane-thinning effect to further reduce the energetic barrier for translocation of charged or polar segments of substrate proteins.

What approaches can be used to study YidC-substrate interactions?

Several experimental approaches can be employed to study YidC-substrate interactions:

MethodApplicationAdvantagesLimitations
In vitro crosslinkingIdentification of proximity between YidC and nascent membrane proteinsCan capture transient interactionsMay introduce artifacts due to crosslinker chemistry
Site-directed mutagenesisDetermine critical residues in YidC-substrate interactionsProvides specific functional informationLabor-intensive; may affect protein folding
Proteoliposome reconstitutionDefined system to study direct YidC effectsEliminates confounding factors present in cellsMay not fully recapitulate native membrane environment
Fluorescence resonance energy transfer (FRET)Monitor real-time dynamics of interactionsNon-invasive; can measure distancesRequires fluorophore labeling that may affect function
Genetic suppressor analysisIdentify functional relationshipsWorks in native cellular contextIndirect; requires specialized genetic tools

Crosslinking experiments have been particularly informative, showing that YidD (a protein encoded by a gene adjacent to yidC) is in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon . This suggests that YidD might be involved in the insertion process alongside YidC.

How can researchers express and purify functional recombinant YidC?

Expression and purification of functional recombinant YidC requires careful consideration of several factors:

  • Expression system selection: E. coli is commonly used for expressing YidC from various bacterial species, including Shewanella putrefaciens as demonstrated in the available information . For Pseudoalteromonas haloplanktis YidC, a cold-adapted expression system might be beneficial given the psychrophilic nature of this organism.

  • Fusion tags and constructs: N-terminal or C-terminal His-tags are frequently used to facilitate purification . The tag position should be chosen to minimize interference with protein function. Some studies use the full-length protein (e.g., residues 1-541 for Shewanella putrefaciens YidC) , while others may focus on specific domains.

  • Membrane extraction: Since YidC is an integral membrane protein, efficient extraction from the membrane requires appropriate detergents. A variety of detergents such as n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin can be tested for optimal extraction efficiency while maintaining protein function.

  • Purification strategy: A typical purification workflow includes:

    • Membrane preparation from expressing cells

    • Detergent solubilization of membrane proteins

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for further purification and detergent exchange

    • Quality control by SDS-PAGE (aiming for >90% purity)

  • Functional verification: The activity of purified YidC can be verified through reconstitution into proteoliposomes followed by membrane protein insertion assays using model substrates like the Pf3 coat protein .

  • Storage considerations: Lyophilization has been used for long-term storage of purified YidC , though repeated freezing and thawing should be avoided. Working aliquots can be stored at 4°C for short-term use .

What genetic approaches can be used to study YidC function in vivo?

Several genetic approaches can be used to study YidC function in bacterial cells:

  • Gene knockout and depletion strategies: Since YidC is essential in many bacteria, conditional depletion systems are often used. The ΔyidD strain construction methodology described in the search results provides a template for gene inactivation strategies: using the Datsenko and Wanner method with PCR-amplified kanamycin cassettes, followed by red-mediated recombination and selection for kanamycin-resistant colonies .

  • Complementation studies: Wild-type or mutant versions of YidC can be expressed from plasmids in YidC-depleted cells to assess functional rescue. This approach helps identify critical domains and residues.

  • Reporter fusion systems: Fusing YidC substrates with reporters like alkaline phosphatase or green fluorescent protein can provide quantitative readouts of insertion efficiency in different genetic backgrounds.

  • Suppressor screens: Isolating suppressors of YidC mutant phenotypes can identify functional interactions with other components of the membrane protein insertion machinery.

  • Analysis of polycistronic gene expression: Since yidC is located in a conserved gene cluster with rpmH, rnpA, yidD, and trmE , techniques to analyze coordinated gene expression can provide insights into the regulation of YidC production.

  • Promoter analysis: Multiple promoters have been identified upstream of genes in the YidC cluster, including internal promoters that may regulate YidC expression independently . Promoter fusion reporters can help elucidate these regulatory mechanisms.

How can researchers investigate the structural dynamics of YidC during protein insertion?

Investigating the structural dynamics of YidC during protein insertion requires a combination of experimental and computational approaches:

  • Time-resolved crosslinking: This technique can capture YidC-substrate interactions at different stages of the insertion process, providing a timeline of structural changes.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): HDX-MS can reveal regions of YidC that undergo conformational changes during substrate binding and insertion by measuring changes in hydrogen-deuterium exchange rates.

  • Single-molecule FRET: By labeling specific sites on YidC and its substrate with fluorophore pairs, researchers can monitor distance changes during the insertion process at the single-molecule level.

  • EPR spectroscopy: Site-directed spin labeling combined with EPR spectroscopy can provide information about local conformational changes and dynamics.

  • Molecular dynamics simulations: As highlighted in the search results, both equilibrium and non-equilibrium MD simulations have proven effective for investigating the conformational dynamics of YidC . These computational approaches can provide atomic-level details of:

    • Local conformational changes in the hydrophilic groove

    • Global structural rearrangements during substrate binding

    • Lipid-protein interactions during the insertion process

    • Energy landscapes of the insertion mechanism

  • Targeted MD simulations: This specific approach can be used to study the transfer of substrate proteins across the membrane, as demonstrated for the Pf3 coat protein system .

By combining these approaches, researchers can build a comprehensive understanding of how YidC dynamically facilitates membrane protein insertion.

What factors influence the specificity of YidC for different substrate proteins?

Several factors influence YidC's substrate specificity:

  • Hydrophobicity of transmembrane segments: Proteins with extended hydrophobic regions can insert independently of YidC into the membrane both in vivo and in vitro, while those with shorter or less hydrophobic transmembrane segments may strictly require YidC .

  • Charge distribution: The distribution of charged residues, particularly positive charges (following the "positive-inside rule"), can affect the requirement for YidC assistance during insertion.

  • Structural complexity: Single-spanning membrane proteins like Pf3 coat protein are classical YidC substrates , while multi-spanning proteins with complex topologies may require additional factors.

  • Auxiliary factors: Proteins like YidD, which is encoded by a gene adjacent to yidC in a highly conserved gene cluster, may contribute to the insertion and processing of YidC-dependent inner membrane proteins .

  • Energy requirements: Some YidC-dependent substrates also require membrane potential for efficient insertion, suggesting multiple energetic constraints on the insertion process .

Understanding these specificity determinants is crucial for predicting which membrane proteins will rely on YidC for their biogenesis and for designing experiments to study YidC function using appropriate model substrates.

How can researchers distinguish between Sec-dependent and Sec-independent roles of YidC?

Distinguishing between Sec-dependent and Sec-independent roles of YidC can be accomplished through several experimental approaches:

  • Selective inhibition of Sec system: Protease-treated inverted inner membrane vesicles (INVs) blocked for Sec-dependent transport can be used to study Sec-independent YidC functions. If membrane protein insertion occurs in these conditions, it suggests a Sec-independent pathway .

  • Reconstituted systems: Proteoliposomes containing purified YidC without Sec components can demonstrate direct YidC-mediated insertion. This approach has successfully shown that YidC alone is sufficient for Pf3 coat protein insertion .

  • Sec depletion vs. YidC depletion: Comparing the effects of Sec component depletion and YidC depletion on the insertion of various membrane proteins can reveal which proteins strictly require both systems or can use YidC independently.

  • Sequential crosslinking: For Sec-dependent substrates like FtsQ, nascent chains first contact SecY and then YidC during insertion . This sequential interaction pattern differs from the direct YidC interaction observed with Sec-independent substrates.

  • Substrate mutations: Strategic mutations in substrate proteins can sometimes convert a Sec-dependent protein to a Sec-independent one or vice versa, revealing the determinants of pathway selection.

These approaches have established that YidC can function both in conjunction with and independently of the Sec translocase, highlighting its versatile role in membrane protein biogenesis.

What are the emerging techniques for studying YidC-mediated membrane protein insertion?

Several emerging techniques are advancing our understanding of YidC-mediated membrane protein insertion:

  • Cryo-electron microscopy (cryo-EM): High-resolution cryo-EM structures of YidC-substrate complexes can provide detailed insights into the insertion mechanism.

  • Native mass spectrometry: This technique can analyze intact membrane protein complexes, potentially revealing transient YidC interactions with substrates and other components of the insertion machinery.

  • In-cell NMR spectroscopy: Developing in-cell NMR methods for membrane proteins could allow observation of YidC conformational changes in a native environment.

  • Single-molecule force spectroscopy: This approach can measure the forces involved in YidC-mediated membrane protein insertion and folding.

  • Advanced molecular dynamics: Enhanced sampling techniques and longer simulation timescales are improving our ability to model the complete insertion process computationally .

  • Integrative structural biology: Combining multiple experimental data sources (crosslinking, HDX-MS, FRET, etc.) with computational modeling to build comprehensive models of the insertion process.

  • Cell-free expression systems: Coupled transcription-translation systems reconstituted with defined components allow precise control over the insertion environment.

These techniques are helping researchers address fundamental questions about the mechanism and energetics of YidC-mediated membrane protein insertion.

How does the study of Pseudoalteromonas haloplanktis YidC contribute to our understanding of cold adaptation in membrane protein biogenesis?

Studying YidC from the psychrophilic bacterium Pseudoalteromonas haloplanktis can provide valuable insights into cold adaptation mechanisms for membrane protein biogenesis:

  • Structural adaptations: Comparison of P. haloplanktis YidC with homologs from mesophilic bacteria like E. coli can reveal structural features that enhance flexibility and activity at low temperatures.

  • Lipid interactions: Cold-adapted YidC may have evolved specific interactions with membrane lipids that maintain fluidity and functionality at low temperatures.

  • Energy requirements: The energetic requirements for membrane protein insertion may differ in psychrophilic organisms, potentially affecting YidC's dependence on membrane potential.

  • Substrate recognition: Cold-adapted YidC might exhibit altered substrate specificity or interaction dynamics compared to mesophilic homologs.

  • Expression and stability: Recombinant expression of P. haloplanktis YidC in different systems can reveal factors affecting the stability and activity of cold-adapted membrane proteins.

By studying these aspects, researchers can gain insights not only into organism-specific adaptations but also into fundamental principles of membrane protein insertion that are conserved or modified in response to environmental pressures like temperature.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.