Recombinant Pseudoalteromonas haloplanktis Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

coli-Based Expression

The protein is predominantly expressed in E. coli under optimized conditions:

  • Vector: Plasmid-based systems with inducible promoters (e.g., T7/lac) .

  • Yield: ~1.0 mg/mL after affinity chromatography .

  • Advantages: Rapid production (24–48 hours) and scalability .

haloplanktis Biofilm Production

Recent studies highlight biofilm-grown P. haloplanktis as an alternative platform:

  • Media: Synthetic GG medium with reduced carbon sources (no antibiotics required) .

  • Induction: IPTG added at 0 hours yields maximal fluorescence in GFP/mScarlet-tagged NqrE .

  • Benefits:

    • Enhanced protein solubility (e.g., mScarlet purity increased by 30% vs. planktonic systems) .

    • Lower protease activity due to cold-adapted host physiology .

Functional Insights

  • Na⁺ Translocation: NqrE collaborates with subunits NqrA–D to form a functional Na⁺-NQR complex, critical for maintaining sodium gradients in extremophiles .

  • Structural Stability: Retains activity at 4–15°C, making it ideal for cryo-EM studies .

Strain Engineering Advances

Genetic modifications to P. haloplanktis TAC125 have improved recombinant yields:

  • Plasmid Curing: Removal of the pMEGA megaplasmid (64.7 kb) via PTasRNA silencing enhanced oxidative stress resistance but reduced biofilm formation .

  • Promoter Optimization: IPTG-inducible systems in strain KrPL LacY+ increased expression 4-fold at 0°C .

Table: Impact of pMEGA Plasmid Curing on Host Physiology

ParameterWild-Type (pMEGA⁺)KrPL 2 (pMEGA⁻)
Biofilm Biomass12.3 µm³/µm²6.7 µm³/µm²
Oxidative Stress ResistanceModerateHigh
Recombinant Yield0.8 mg/mL1.2 mg/mL

Challenges and Future Directions

  • Heterologous Expression: Poor solubility in mesophilic hosts remains a hurdle .

  • Biofilm Scalability: Longer production timelines (96+ hours) limit industrial adoption .

  • Synthetic Biology: CRISPR editing of nqrE operons could enhance electron transfer efficiency .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend consulting your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; PSHAa2237; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pseudoalteromonas haloplanktis (strain TAC 125)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKAVFIENLALSFFLGMCTFLAVSKKVTTSIGLGVAVIVVLGISVPVNNLVY HAVLAPGSLTWLGYPDADLSFLRFLTFIGVIAALVQILEMALDKFFPALYNALGIFLPLI TVNCAIFGAVSFMVERNYNFGESVVYGIGAGVGWALAITLLAGIREKMKYSDVPDGLRGL GITFITVGLMALGFMSFSGISL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudoalteromonas haloplanktis Na(+)-translocating NADH-quinone reductase subunit E (nqrE)?

Pseudoalteromonas haloplanktis Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is a protein component of the Na(+)-translocating NADH-quinone reductase (Na(+)-NQR) complex found in the Antarctic marine bacterium Pseudoalteromonas haloplanktis. This complex is a respiratory enzyme that couples the oxidation of NADH to the transport of sodium ions across the cell membrane. The nqrE subunit is one of several integral membrane components that form the ion translocation pathway within the complex. Structurally, nqrE contains multiple transmembrane domains that anchor it within the cell membrane, allowing it to participate in the electron transport chain while facilitating sodium ion movement. The protein shares significant homology with the nqrE subunit in other marine bacteria such as Pseudoalteromonas atlantica, where it serves a similar functional role in energy metabolism .

How does nqrE function within the Na(+)-NQR complex?

The nqrE subunit functions as an integral component of the Na(+)-NQR complex, playing a crucial role in the coupling mechanism between electron transport and sodium ion translocation. Within this multimeric enzyme complex, nqrE positions itself in the membrane to form part of the sodium ion channel. The protein participates in the transfer of electrons through the respiratory chain while simultaneously contributing to conformational changes that drive sodium ion movement across the membrane. The electron transport pathway involves redox centers in multiple subunits, including nqrE, which contains amino acid residues that may interact with quinones or other electron carriers. When examining related proteins such as the P. atlantica nqrE, we observe that the protein contains specific transmembrane regions and conserved residues that form the ion translocation pathway . The function of nqrE is particularly important in marine bacteria that have adapted to high-salt environments, where sodium ion gradients are utilized for energy conservation instead of or in addition to proton gradients.

What expression systems are suitable for producing recombinant Pseudoalteromonas haloplanktis nqrE?

Several expression systems can be employed for producing recombinant Pseudoalteromonas haloplanktis nqrE, with the optimal choice depending on research objectives. Escherichia coli remains the most widely used host, as demonstrated with the related P. atlantica nqrE protein, which has been successfully expressed in E. coli with an N-terminal His tag . For expressing cold-adapted proteins like those from P. haloplanktis, it is advisable to use cold-inducible promoters and lower incubation temperatures (15-20°C) to improve protein folding and solubility. Researchers should consider utilizing expression vectors containing strong, inducible promoters such as T7 or tac, coupled with appropriate selection markers. Alternatively, the use of P. haloplanktis TAC125 itself as an expression host presents significant advantages for producing its native proteins, particularly when grown in biofilm conditions. Recent research has demonstrated that P. haloplanktis biofilms can efficiently produce recombinant proteins with advantages over planktonic culture, including reduced carbon source requirements and elimination of antibiotic selection pressure . This approach may be particularly valuable for membrane proteins like nqrE that often present folding challenges in heterologous systems.

How should experiments be designed to optimize recombinant production of P. haloplanktis nqrE?

Designing experiments for optimizing recombinant production of P. haloplanktis nqrE requires a systematic approach with carefully defined variables and controls. Begin by defining your independent variables (e.g., expression system, temperature, induction conditions) and dependent variables (protein yield, purity, activity) . Construct a specific, testable hypothesis about which conditions will optimize production. For example, you might hypothesize that biofilm growth conditions will yield higher quality nqrE protein compared to planktonic cultivation. When using P. haloplanktis as the host organism, recent research indicates that biofilm cultivation offers significant advantages despite longer growth periods . The experimental design should include optimization of media composition and induction conditions, similar to the approach used for GFP and mScarlet expression in P. haloplanktis TAC125 biofilms .

For membrane proteins like nqrE, consider the following experimental parameters:

ParameterRange to testMeasurement method
Growth temperature4-25°COD600, viable count
Inducer concentration0.1-1.0 mMWestern blot quantification
Carbon sourceGlucose, glycerol (0.5-2%)Protein yield, membrane integration
Cultivation time24-120 hoursTime-course protein expression
Biofilm vs. planktonicBoth conditionsProtein quality assessment

Control for extraneous variables by maintaining consistent inoculum density, pH, and aeration conditions across experimental groups. Include appropriate negative controls (non-induced cultures) and positive controls (well-expressed control protein) .

What purification strategies are most effective for recombinant P. haloplanktis nqrE?

Purification of recombinant P. haloplanktis nqrE requires specialized approaches due to its membrane-associated nature. Based on protocols used for similar proteins, a multi-step purification strategy is recommended. If expressing with a His-tag as done with P. atlantica nqrE , begin with membrane isolation through differential centrifugation following cell lysis. The membrane fraction should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration. Maintain detergent throughout all subsequent purification steps to prevent protein aggregation.

Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as the primary purification step for His-tagged nqrE, with elution performed using an imidazole gradient (50-300 mM). Size exclusion chromatography should follow as a polishing step to separate the properly folded protein from aggregates and to exchange buffers. Throughout purification, include sodium ions (typically 100-200 mM NaCl) in all buffers to stabilize the protein's native conformation. Monitor purification efficiency at each step using SDS-PAGE and Western blotting. For functional studies, verify protein activity using NADH oxidation assays coupled with monitoring of sodium transport. Expected purity should exceed 90% as assessed by SDS-PAGE, similar to what has been achieved with related proteins .

How can researchers verify the structural integrity and activity of purified nqrE?

Verifying the structural integrity and functional activity of purified nqrE requires a combination of biophysical and biochemical approaches. Begin with structural assessment using circular dichroism (CD) spectroscopy to evaluate secondary structure content, particularly the alpha-helical composition expected for membrane proteins. Thermal stability can be assessed through thermal denaturation monitored by CD or differential scanning fluorimetry. For tertiary structure analysis, limited proteolysis followed by mass spectrometry provides insights into properly folded domains versus disordered regions.

For functional verification, develop a coupled enzyme assay system measuring NADH oxidation spectrophotometrically at 340 nm, while simultaneously monitoring sodium ion movement using sodium-sensitive fluorescent dyes like SBFI or sodium-sensitive electrodes. The activity assay should be performed in reconstituted proteoliposomes to provide a membrane environment for the protein. Establish the following parameters for activity characterization:

ParameterMeasurement methodExpected range
NADH oxidation rateDecrease in A34010-100 nmol/min/mg protein
Na+ translocationFluorescence change (SBFI)Dependent on reconstitution efficiency
Inhibitor sensitivityNADH oxidation with inhibitorsIC50 for specific NQR inhibitors
Quinone reductionAbsorbance changeDependent on quinone type

Additionally, assess stability under storage conditions by measuring activity retention over time. For correctly folded nqrE stored in appropriate buffer with 6% trehalose at -80°C, activity should be retained for several months, with minimal loss from freeze-thaw cycles .

How does biofilm cultivation affect the quality of recombinant P. haloplanktis proteins compared to planktonic growth?

Biofilm cultivation significantly impacts the quality of recombinant proteins produced in P. haloplanktis, offering several advantages over traditional planktonic growth. Recent research with P. haloplanktis TAC125 has demonstrated that while biofilm production takes longer than planktonic methods, it yields proteins of comparable or superior quality . For the fluorescent protein mScarlet, biofilm production outperformed planktonic systems in producing higher quality recombinant product . This quality difference likely results from the different physiological state of cells within biofilms, where slower growth rates and stress responses may enhance protein folding pathways and chaperone activity.

The biofilm approach offers additional benefits particularly relevant for membrane proteins like nqrE. Biofilm cultivation requires lower concentrations of carbon sources, reducing metabolic burden on cells, and importantly, doesn't require continuous antibiotic selection pressure . This antibiotic-free production is particularly valuable for membrane proteins that may be sensitive to antibiotic-induced membrane stress. The extracellular matrix of biofilms may also provide a protective environment that maintains protein stability during expression.

When expressing membrane proteins like nqrE in biofilms, researchers should optimize attachment surfaces, media composition, and harvesting techniques. The construction of specialized expression vectors suitable for biofilm conditions, as demonstrated in recent studies , is essential for maximizing production efficiency. Quantitative comparison between biofilm and planktonic production should assess not only total yield but also specific activity, proper membrane integration, and post-translational modifications.

What structural features distinguish P. haloplanktis nqrE from homologous proteins in mesophilic bacteria?

P. haloplanktis nqrE exhibits several structural adaptations that distinguish it from homologous proteins in mesophilic bacteria, reflecting its evolution in cold Antarctic marine environments. Comparative analysis with the P. atlantica nqrE sequence and other mesophilic homologs reveals key cold-adaptation features. These typically include a higher proportion of glycine residues providing increased backbone flexibility, reduced proline content in loops, and decreased hydrophobic core packing. The amino acid composition frequently shows a higher ratio of charged versus hydrophobic residues on the protein surface, enhancing solubility at low temperatures.

Transmembrane domain analysis of nqrE proteins shows specific adaptations in P. haloplanktis that may enhance membrane fluidity interactions at low temperatures. These include:

  • Modified hydrophobic amino acid distribution in transmembrane segments

  • Altered charged residue positioning at membrane interfaces

  • Specific substitutions in conserved functional motifs that maintain activity at lower activation energies

These psychrophilic adaptations are functionally significant, allowing the Na(+)-NQR complex to maintain efficient energy coupling at temperatures as low as 4°C. Researchers studying cold-adapted membrane proteins should consider these structural differences when designing expression systems, purification methods, and activity assays. When working with recombinant P. haloplanktis nqrE, maintaining lower temperatures throughout purification (4-15°C) is essential to preserve these unique structural features that might be destabilized at higher temperatures.

How can researchers investigate the Na+ translocation mechanism of recombinant nqrE?

Investigating the Na+ translocation mechanism of recombinant nqrE requires sophisticated biophysical techniques combined with molecular biology approaches. Begin by reconstituting purified nqrE into proteoliposomes or nanodiscs to create a controlled membrane environment. The reconstitution system should allow manipulation of both internal and external sodium concentrations to establish gradients. Site-directed mutagenesis of conserved residues within the transmembrane domains is essential for identifying amino acids directly involved in sodium coordination and translocation.

For direct measurement of sodium transport, 22Na+ radioisotope flux assays provide quantitative data on transport rates. Additionally, sodium-sensitive fluorescent probes can be employed for real-time monitoring of transport in reconstituted systems. Voltage-clamp electrophysiology using nqrE-reconstituted planar lipid bilayers or patch-clamped giant vesicles allows precise measurement of ion currents associated with sodium movement.

The following experimental approach is recommended:

  • Generate a library of point mutations in conserved residues based on sequence alignment with P. atlantica nqrE and other homologs

  • Express and purify each mutant using optimized biofilm or E. coli expression systems

  • Reconstitute proteins into liposomes with controlled lipid composition

  • Measure sodium transport using multiple complementary techniques

  • Correlate transport activity with structural changes using spectroscopic methods

For data analysis, develop kinetic models incorporating binding affinities, transport rates, and coupling ratios. Compare experimental results with computational predictions from molecular dynamics simulations of nqrE within lipid bilayers. This multidisciplinary approach will provide mechanistic insights into how specific residues and structural elements contribute to sodium ion selectivity, binding, and translocation through the nqrE subunit.

How does the function of nqrE from P. haloplanktis compare with homologous proteins from other extremophiles?

The function of nqrE from psychrophilic P. haloplanktis shows distinctive properties when compared with homologous proteins from other extremophiles, reflecting diverse evolutionary adaptations to extreme environments. Unlike thermophilic Na(+)-NQR complexes that demonstrate high thermal stability but reduced flexibility, the P. haloplanktis nqrE exhibits enhanced conformational flexibility at low temperatures, allowing efficient sodium translocation in cold environments. This contrasts with halophilic homologs, which have evolved to function optimally at high salt concentrations through negative surface charge accumulation.

Comparison studies should systematically evaluate:

ParameterP. haloplanktis nqrEThermophilic homologsHalophilic homologs
Temperature optimum4-15°C50-80°C20-45°C
Salt concentration optimum0.2-0.5 M NaCl0.1-0.3 M NaCl1-4 M NaCl
Structural flexibilityHighLowModerate
Ion specificityNa+ > Li+ > K+VariableStrict Na+ specificity
Activation energyLowerHigherModerate

When designing experiments to compare these homologs, researchers should express and purify each protein under conditions that preserve their native properties. Activity assays must be conducted across relevant temperature and salinity ranges to generate comprehensive activity profiles. Structural studies using hydrogen-deuterium exchange mass spectrometry can reveal differences in dynamic regions between homologs, providing insights into adaptive flexibility. Understanding these functional differences contributes to our broader knowledge of ion-translocating membrane proteins and may inform biotechnological applications in diverse environmental conditions.

What are the challenges in scaling up production of recombinant P. haloplanktis nqrE for structural studies?

Scaling up production of recombinant P. haloplanktis nqrE for structural studies presents several technical challenges that researchers must address systematically. As a membrane protein from a psychrophilic organism, nqrE presents unique expression, stabilization, and purification hurdles when produced in quantities sufficient for crystallography, cryo-electron microscopy, or NMR studies.

The primary challenges include:

  • Achieving sufficient expression levels while maintaining protein quality. For structural studies, protein yields typically need to exceed 1-5 mg per liter of culture. While E. coli expression systems have been used successfully for related proteins , expression of cold-adapted membrane proteins often results in misfolding or aggregation. Biofilm cultivation of P. haloplanktis itself offers a promising alternative approach , but scaling biofilm reactors presents engineering challenges in maintaining uniform biofilm formation and nutrient diffusion.

  • Maintaining protein stability throughout purification. The intrinsic instability of membrane proteins is compounded for psychrophilic proteins like P. haloplanktis nqrE, which may unfold at moderate temperatures. Researchers must develop purification protocols that maintain low temperatures (4-10°C) throughout all steps while efficiently removing contaminants.

  • Finding appropriate detergents or membrane mimetics that preserve native structure. For structural studies, detergent selection is critical, as it must efficiently extract nqrE from membranes while preserving its native conformation and activity. Researchers should screen multiple detergents and newer membrane mimetics like nanodiscs, SMALPs, or amphipols that better approximate the native membrane environment.

The optimization strategy should involve parallel testing of expression conditions in both E. coli and P. haloplanktis biofilm systems, followed by detergent screening and stability assessment through size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS). For structural studies requiring isotopic labeling, developing minimal media formulations that support cold-adapted growth while incorporating labeled nitrogen or carbon sources presents additional challenges that must be addressed through systematic optimization.

What future research directions could expand our understanding of P. haloplanktis nqrE function?

Future research on P. haloplanktis nqrE should pursue several promising directions to expand our understanding of this protein's structure, function, and potential applications. Emerging technologies and interdisciplinary approaches offer opportunities to address fundamental questions about this cold-adapted membrane protein.

Key research directions include:

  • Cryo-EM structural determination: Utilizing advances in cryo-electron microscopy to resolve the structure of the complete Na(+)-NQR complex from P. haloplanktis, focusing on the arrangement of nqrE within the larger complex and identifying specific structural features that facilitate cold adaptation.

  • Single-molecule biophysics: Applying techniques like single-molecule FRET or high-speed AFM to observe conformational changes in nqrE during the sodium translocation cycle, providing insights into the dynamics of the transport mechanism at low temperatures.

  • Synthetic biology applications: Engineering P. haloplanktis nqrE and the Na(+)-NQR complex as modules for controlling sodium gradients in synthetic cells or as components in bioelectronic devices that function at low temperatures.

  • Comparative genomics and evolutionary studies: Examining nqrE sequence variation across psychrophilic marine bacteria to identify convergent adaptations and conserved functional elements through phylogenetic analysis.

  • Integration with artificial intelligence approaches: Using machine learning to predict functional residues and structure-function relationships in nqrE based on sequence data and limited experimental constraints, guiding more efficient experimental design.

For designing these future studies, researchers should leverage the optimization of biofilm-based recombinant protein production systems and apply rigorous experimental design principles . Collaborative approaches combining expertise in structural biology, biophysics, microbiology, and computational modeling will be essential for addressing the complex questions surrounding this fascinating cold-adapted membrane protein and its role in bacterial energy metabolism under extreme conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.