Recombinant Pseudoalteromonas haloplanktis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Pseudoalteromonas haloplanktis Lgt is a modified form of the native enzyme responsible for catalyzing the first step in lipoprotein biosynthesis. It transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of prolipoproteins, forming a thioether bond critical for membrane anchoring . This post-translational modification is essential for bacterial outer membrane stability, virulence, and resistance to host defenses .

Enzymatic Mechanism

Lgt operates via a conserved catalytic process:

  • Substrates: Phosphatidylglycerol (donor) and prolipoproteins containing a -Lipobox- motif (e.g., Leu-Ala-Ala-Cys) .

  • By-products: Glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) .

  • Detection: Activity is measured using coupled luciferase assays to quantify G3P release .

Key residues (e.g., Tyr26, Asn146, Gly154) in Lgt’s transmembrane domains are essential for function, as shown by mutagenesis studies in Escherichia coli . The enzyme’s structure includes seven transmembrane segments, with catalytic regions facing the periplasm .

Expression System

  • Host: Pseudoalteromonas haloplanktis TAC125, an Antarctic marine bacterium optimized for cold-adapted protein production .

  • Vector: IPTG-inducible plasmids (e.g., pP79) enable controlled expression .

  • Strain Engineering: Mutant strains like KrPL LacY+ enhance inducer (IPTG) uptake and reduce protease interference .

Biochemical and Functional Insights

  • Inhibitor Studies: Novel Lgt inhibitors (e.g., G9066, G2823) show potent activity (in vitro IC<sub>50</sub> = 0.18–0.93 μM) against E. coli and Acinetobacter baumannii Lgt homologs .

  • Essentiality: Genetic depletion of lgt in pathogenic E. coli causes outer membrane destabilization, increasing antibiotic susceptibility .

  • Resistance Mechanisms: Unlike downstream lipoprotein pathway inhibitors, Lgt-targeting compounds bypass resistance linked to lpp (major outer membrane lipoprotein) deletion .

Therapeutic Target

  • Lgt is a validated antibacterial target due to its role in membrane biogenesis and absence of off-target resistance in clinical strains .

  • Inhibitors disrupt lipoprotein anchoring, leading to cell lysis and enhanced serum killing .

Biotechnological Use

  • Model Enzyme: Used to study cold-adapted enzyme kinetics and structure-function relationships .

  • Tool for Protein Engineering: P. haloplanktis’s secretion systems enable high-yield recombinant Lgt production for industrial applications .

Research Challenges and Future Directions

  • Structural Studies: No crystallographic data for P. haloplanktis Lgt exists; homology modeling based on E. coli Lgt (PDB: 6V7M) is limited .

  • Mechanistic Gaps: Competitive inhibition dynamics (phosphatidylglycerol vs. prolipoprotein binding) remain unresolved .

  • Delivery Optimization: Improving Lgt inhibitor permeability across Gram-negative membranes is critical for clinical translation .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we will accommodate any special format requests. Please specify your requirements when placing the order.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
lgt; PSHAa0748; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Pseudoalteromonas haloplanktis (strain TAC 125)
Target Names
lgt
Target Protein Sequence
MALEFPVIDPIIFSVGPLSVRWYGLMYLIGFAFAMWFANRQAAKPNSGWTKDQVGDFLFY GMLGVILGGRIGYVLFYQFSYFIENPLYLFRIDQGGMSFHGGTLGVITAVVIFAWTRKKS ILQVGDFVAPLVPVGLLAGRIGNFINGELWGRVSDVPWAMVFPTGGPLARHPSQLYEAFF EGLVLFLILQWFIKKPRPAGSVAGVFLLGYGTFRFCIEYFRQPDAQLGLFADFISMGQIL SLPMIVGGLGLLIWAYKQATQKTAVKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) from Pseudoalteromonas haloplanktis?

Prolipoprotein diacylglyceryl transferase (lgt) from Pseudoalteromonas haloplanktis is an enzyme (EC 2.4.99.-) responsible for initiating the unique bacterial N-terminal lipid modification process, specifically the N-acyl S-diacylglyceryl modification of N-terminal cysteine residues in target proteins . This cold-adapted enzyme is derived from the Antarctic marine bacterium Pseudoalteromonas haloplanktis strain TAC 125, which has gained significant attention for its psychrophilic properties. The full-length protein consists of 267 amino acids with a UniProt accession number of Q3IDN2 and is encoded by the lgt gene (locus PSHAa0748) .

How does the substrate specificity of P. haloplanktis lgt compare to other bacterial lgt enzymes?

Research using synthetic peptide substrates has demonstrated that P. haloplanktis lgt, like other bacterial lgt enzymes, lacks substrate preference based on hydrophobicity . This is particularly significant as it contradicts earlier assumptions derived from studies using prototypical substrates with hydrophobic signal peptides. The enzyme can effectively process substrates with short hydrophilic h-regions (e.g., MKATKSAVGSTLAGCSSHHHHHH), which may explain the significant diversity of bacterial lipoproteins possessing hydrophilic signal peptides .

This flexibility in substrate recognition appears to be a conserved feature across bacterial lgt enzymes, though the cold-adapted nature of P. haloplanktis lgt may confer unique kinetic properties that distinguish it from mesophilic homologs. Comparative analyses with well-characterized lgt enzymes from other bacterial species would provide further insights into the evolutionary adaptations of this enzyme family.

What are the optimal conditions for recombinant production of P. haloplanktis lgt?

The optimal conditions for recombinant production of P. haloplanktis lgt should consider both the expression system and growth parameters. While the search results don't specifically address lgt production, insights can be drawn from the successful production of other recombinant proteins in P. haloplanktis TAC125:

Temperature: As a cold-adapted enzyme, expression at 15°C is recommended to maintain protein functionality .

Growth Medium: Studies with other recombinant proteins in P. haloplanktis show successful expression in modified GG medium. For biofilm-based production, a reduced carbon source concentration (5/5 GG) with increased iron sulfate (70 mg/L FeSO₄) has proven effective .

Induction Parameters: For IPTG-inducible systems, induction at the beginning of growth (0.2 OD₆₀₀ₙₘ) with 5 mM IPTG has shown optimal results for biofilm-based production, while induction during exponential phase (1.0-1.5 OD₆₀₀ₙₙ) is preferable for planktonic cultures .

Storage Conditions: The recombinant protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided .

What expression systems are most effective for producing soluble, active P. haloplanktis lgt?

Based on research with other recombinant proteins from P. haloplanktis, two main expression strategies show promise:

  • Homologous Expression in P. haloplanktis TAC125: This approach leverages the native cellular machinery optimized for cold-adapted protein folding. Recent studies demonstrate that P. haloplanktis TAC125 itself can serve as an excellent host for recombinant protein production, particularly for challenging proteins that form inclusion bodies in conventional expression systems .

    The use of regulated psychrophilic gene expression systems combined with optimized fermentation processes in defined growth medium has proven successful for obtaining fully soluble and correctly localized recombinant proteins, including those with complex folding requirements like antibody fragments .

  • Biofilm-Based Production System: A novel approach using P. haloplanktis grown in biofilm conditions has shown promising results for producing recombinant proteins:

    Production ParameterBiofilm SystemPlanktonic System
    Carbon Source RequirementLowerHigher
    Antibiotic RequirementNot neededRequired
    Production TimeLonger (96h optimal)Shorter (72h)
    Product QualitySometimes superiorVariable
    Induction TimingEarly (0h)Mid-exponential phase

    For certain proteins like mScarlet, biofilm-based production outperforms planktonic systems in terms of product quality, despite the longer production time .

How can solubility issues be addressed when producing recombinant P. haloplanktis lgt?

Solubility challenges with recombinant lgt can be addressed through several strategies:

  • Expression Host Selection: The use of P. haloplanktis TAC125 itself as an expression host has proven effective for producing soluble recombinant proteins that typically form inclusion bodies in conventional microbial cell factories . This homologous expression approach leverages the psychrophilic cellular machinery optimized for proper protein folding at low temperatures.

  • Periplasmic Targeting: Directing the recombinant protein to the periplasmic space can enhance solubility and proper folding. Studies with antibody fragments in P. haloplanktis TAC125 demonstrate successful translocation to the host periplasmic space, resulting in fully soluble protein .

  • Buffer Optimization: Given lgt's peripheral association with membranes and its extraction properties, using low ionic strength solutions during purification may help maintain solubility. The enzyme can be readily extracted with water or low ionic strength solutions from inverted vesicles, suggesting these conditions favor its soluble state .

  • Temperature Management: Maintaining consistently low temperatures (15°C) throughout expression and purification processes is critical for preserving the native structure of cold-adapted enzymes .

What methods are available for assaying P. haloplanktis lgt enzymatic activity?

Several methodologies can be employed to assess the enzymatic activity of P. haloplanktis lgt:

  • Paper Electrophoretic Assay: A direct, accurate, and relatively simple method described for lgt activity assessment. This technique offers advantages in terms of precision and ease of implementation compared to earlier methodologies .

  • Synthetic Peptide Substrate Assay: Using defined synthetic peptide substrates such as MKATKSAVGSTLAGCSSHHHHHH to monitor the transfer of the diacylglyceryl moiety from phosphatidylglycerol to the target peptide .

  • Comparative Kinetic Analysis: Comparing the kinetic parameters of membrane-bound versus solubilized enzyme preparations can provide insights into the structural requirements for enzymatic activity. Research indicates that except for heat stability, the soluble enzyme exhibits similar kinetic behavior to the membrane-bound form .

The assay choice should be guided by specific research questions, available equipment, and the need for quantitative versus qualitative data. For comprehensive characterization, combining multiple assay approaches is recommended.

How does the cold adaptation of P. haloplanktis lgt affect its enzymatic properties?

The cold adaptation of P. haloplanktis lgt manifests in several distinctive enzymatic properties:

  • Heat Lability: Unlike mesophilic homologs, the cold-adapted lgt displays reduced thermal stability, a common characteristic of psychrophilic enzymes that allows for greater structural flexibility at low temperatures .

  • Activity Profile: The enzyme maintains catalytic efficiency at low temperatures (4-15°C), whereas mesophilic variants typically show dramatically reduced activity under these conditions .

  • Membrane Association: While research specifically on lgt is limited, studies on other cold-adapted enzymes from P. haloplanktis suggest modified membrane interactions as part of their cold adaptation strategy. In the case of lgt, its peripheral rather than integral membrane association may represent a cold-adaptive feature enabling activity in the polar environment .

  • Solubility Characteristics: The enzyme's ability to function in a solubilized state, with kinetic parameters similar to the membrane-bound form, may reflect evolutionary adaptations to function in the cold Antarctic marine environment .

These properties align with general principles of protein cold adaptation, which typically involve increased structural flexibility and reduced stability to maintain catalytic efficiency at low temperatures.

What is the significance of lgt in bacterial lipid modification and potential biotechnological applications?

The lgt enzyme holds substantial significance in both fundamental microbiology and applied biotechnology:

  • Essential Role in Bacterial Physiology: Lgt catalyzes the committed first step in bacterial lipoprotein biogenesis, a post-translational modification essential for proper protein localization and function in bacterial membranes .

  • Unique Modification Chemistry: The N-acyl S-diacylglyceryl modification of N-terminal cysteine catalyzed by lgt represents a unique biochemical process not found in eukaryotic systems, making it an attractive target for both protein engineering and antimicrobial development .

  • Biotechnological Applications:

    • Protein Engineering: The ability to introduce lipid anchors can be exploited to create membrane-associated recombinant proteins with enhanced stability or novel functions.

    • Vaccine Development: Lipid-modified proteins often exhibit enhanced immunogenicity, potentially useful for vaccine design.

    • Antimicrobial Target: The essential nature and bacterial specificity of lgt make it a potential target for novel antimicrobial compounds.

  • Cold Enzyme Technology: The psychrophilic nature of P. haloplanktis lgt offers advantages for biotechnological applications requiring low-temperature processes, including reduced energy requirements and minimized unwanted side reactions .

The cold-active properties combined with the unique chemistry catalyzed by lgt create opportunities for developing specialized biotechnological tools and processes not possible with conventional mesophilic enzymes.

What are the recommended procedures for purifying recombinant P. haloplanktis lgt?

Based on experimental approaches used with similar proteins and the specific properties of lgt, the following purification strategy is recommended:

  • Cell Lysis and Initial Extraction:

    • For biofilm-grown cells: Harvest after 96 hours, sonicate twice at 37 kHz for 15 minutes to detach biofilm, and centrifuge at 6,000 rpm for 30 minutes at 4°C .

    • For planktonic cultures: Harvest after 72 hours of growth at 15°C and centrifuge at 13,000 rpm for 20 minutes at 4°C .

  • Membrane Protein Extraction:

    • Given lgt's peripheral membrane association, use gentle extraction methods with low ionic strength buffers rather than harsh detergents .

    • Water or low ionic strength solutions have demonstrated effectiveness in extracting lgt from inverted vesicles while maintaining activity .

  • Chromatographic Purification:

    • If a His-tag is incorporated into the recombinant construct, immobilized metal affinity chromatography (IMAC) provides a selective initial purification step.

    • Follow with size exclusion chromatography to remove aggregates and achieve high purity.

  • Activity Preservation During Purification:

    • Maintain consistently low temperatures (4°C) throughout all purification steps.

    • Include glycerol (10-20%) in buffers to stabilize the psychrophilic enzyme.

    • Consider adding reducing agents to prevent oxidation of cysteine residues.

  • Storage of Purified Protein:

    • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

    • Avoid repeated freeze-thaw cycles; prepare single-use aliquots .

How can researchers verify the structural integrity and proper folding of recombinant P. haloplanktis lgt?

Multiple complementary approaches can be employed to assess the structural integrity and proper folding of recombinant P. haloplanktis lgt:

These methods should be used in combination to build a comprehensive assessment of protein quality, as no single technique provides complete information about structural integrity.

What experimental controls are essential when working with recombinant P. haloplanktis lgt?

Robust experimental design for work with recombinant P. haloplanktis lgt requires several essential controls:

  • Expression Controls:

    • Empty vector control to distinguish host-derived background from recombinant protein expression.

    • Non-induced samples to assess basal expression levels and compare with induced conditions .

    • Time-course sampling to determine optimal expression and harvest time (e.g., 24h, 48h, 72h, 96h) .

  • Activity Assay Controls:

    • Heat-inactivated enzyme as a negative control, exploiting the heat lability of psychrophilic enzymes .

    • Substrate-only control to monitor spontaneous reactions or contaminating activities.

    • Known active enzyme preparation (if available) as a positive control.

  • Protein Solubility and Localization Controls:

    • Analysis of both soluble and insoluble fractions to quantify proportion of correctly folded protein .

    • Membrane fractionation controls to verify the expected peripheral membrane association .

    • Subcellular localization markers to confirm proper targeting within the expression host.

  • Purification Controls:

    • Flow-through samples from each purification step to monitor binding efficiency and potential loss.

    • Buffer-only controls to detect resin-derived contaminants or artifacts.

  • Storage Stability Controls:

    • Fresh vs. stored enzyme comparisons to assess activity retention under different storage conditions .

    • Multiple freeze-thaw cycles test to quantify stability losses from repeated freezing and thawing .

How does the membrane association of P. haloplanktis lgt differ from predicted transmembrane topology models?

Contrary to computational predictions, experimental evidence reveals that P. haloplanktis lgt associates with the inner membrane through peripheral and possibly reversible hydrophobic interactions rather than through stable transmembrane domains . This finding challenges the previously deduced transmembrane topology for lgt enzymes and has significant implications for understanding enzyme function.

Solubilization experiments demonstrate that lgt can be readily extracted from membranes using water or low ionic strength solutions, indicating a relatively weak membrane association that contrasts with the behavior expected for integral membrane proteins . Furthermore, the enzyme appears to associate with the inner membrane on the cytosolic side, which contradicts topological models predicting transmembrane helices with periplasmic domains .

The functional significance of this peripheral association becomes apparent when comparing the kinetic properties of solubilized versus membrane-bound enzyme. With the exception of heat stability, the soluble enzyme exhibits catalytic behavior indistinguishable from the membrane-bound form, suggesting that stable transmembrane integration is not required for enzymatic function . This unexpected membrane interaction pattern may represent an evolutionary adaptation related to the cold-active nature of the enzyme, potentially enhancing the flexibility needed for catalysis at low temperatures.

What are the key differences between biofilm and planktonic expression systems for recombinant protein production in P. haloplanktis?

Recent research has explored biofilm-based recombinant protein production in P. haloplanktis TAC125, revealing several key differences compared to conventional planktonic systems:

ParameterBiofilm SystemPlanktonic SystemImplications
Growth Duration96 hours optimal72 hours optimalBiofilm requires longer production time
Carbon Source RequirementsLower concentration (5/5 GG)Higher concentration (GG)Biofilm system more economical
Antibiotic RequirementCan be eliminatedRequired for plasmid maintenanceReduced costs and simplified medium for biofilm
Induction TimingOptimal at beginning (0h)During exponential phase (1.0-1.5 OD₆₀₀ₙₘ)Different expression kinetics in biofilm
Product QualitySometimes superior (e.g., for mScarlet)VariableProtein-dependent advantages
Biomass RecoveryRequires sonication for biofilm detachmentSimple centrifugationMore complex downstream processing for biofilm

For certain recombinant proteins like mScarlet, the biofilm-based system outperforms planktonic expression in terms of product quality, despite the longer production time . The biofilm environment may provide conditions that favor proper protein folding for some targets, potentially due to the altered physiological state of cells within the biofilm matrix. Additionally, the ability to eliminate antibiotic selection while maintaining plasmid stability represents a significant advantage for scaled-up production .

These findings suggest that the optimal expression system choice should be protein-specific, with biofilm production offering particular advantages for challenging proteins that exhibit folding or quality issues in conventional planktonic systems.

What structural features of P. haloplanktis lgt contribute to its psychrophilic adaptation?

Although comprehensive structural data specifically for P. haloplanktis lgt is limited, general principles of psychrophilic enzyme adaptation combined with available sequence information suggest several key features that likely contribute to its cold adaptation:

These adaptations collectively contribute to maintaining catalytic efficiency at low temperatures by enhancing structural flexibility, reducing energy barriers to conformational changes, and optimizing substrate binding and product release under conditions of reduced thermal energy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.