Recombinant Pseudoalteromonas phage PM2 Protein P3 (III)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
III; Protein P3; Protein III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Pseudoalteromonas phage PM2 (Bacteriophage PM2)
Target Names
III
Target Protein Sequence
MNTSVPTSVPTNQSVWGNVSTGLDALISGWARVEQIKAAKASTGQGRVEQAMTPELDNGA AVVVEAPKKAAQPSETLVFGVPQKTLLLGFGGLLVLGLVMRGNK
Uniprot No.

Target Background

Database Links

KEGG: vg:1262044

Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is Pseudoalteromonas phage PM2 Protein P3 (III) and what is its role in the virion structure?

Pseudoalteromonas phage PM2 Protein P3 (III) is a membrane-associated protein found in the marine bacteriophage PM2. While proteins P1 (a pentameric receptor binding protein) and P2 (the major capsid protein) form the protein coat of the virion, P3 is one of eight proteins (P3 to P10) associated with the phage's lipid membrane . The PM2 virion consists of an icosahedrally organized proteinaceous capsid surrounding a protein-rich lipid membrane that encloses the highly supercoiled circular double-stranded DNA genome .

How does Protein P3 differ from other structural proteins in PM2 phage?

Protein P3 differs from the major structural proteins of PM2 phage (P1 and P2) in its location and likely function. While P1 and P2 form the external protein coat or capsid of the virion, P3 is associated with the internal lipid membrane layer . The PM2 genome is organized into three operons (two early and one late), with most structural proteins, including P3, being encoded by the late operon (OL), which is positively regulated by viral transcription factors P13 and P14 .

What expression systems are most effective for producing recombinant Pseudoalteromonas phage PM2 Protein P3?

Based on available research, the most effective and commonly used expression system for recombinant Pseudoalteromonas phage PM2 Protein P3 is E. coli . The recombinant protein is typically expressed with an N-terminal His-tag for purification purposes. When designing expression systems, researchers should consider using bacterial expression vectors that allow tight control of protein expression, since membrane-associated viral proteins might be toxic to host cells at high concentrations.

What are the recommended storage and handling conditions for purified recombinant Protein P3?

Purified recombinant Protein P3 is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt . For working with the protein, the following guidelines are recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly used) and aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein stability

  • For short-term use, working aliquots can be stored at 4°C for up to one week

What purification strategy yields the highest purity for recombinant His-tagged Protein P3?

For His-tagged recombinant Protein P3, affinity chromatography using nickel or cobalt resins is the primary purification method. To achieve greater than 90% purity (as determined by SDS-PAGE) , a multi-step purification strategy is recommended:

  • Initial capture using Ni-NTA or Co-NTA affinity chromatography under native or denaturing conditions

  • Washing with increasing concentrations of imidazole to remove non-specifically bound proteins

  • Elution with high-concentration imidazole buffer

  • Further purification using size exclusion chromatography to remove aggregates and impurities

  • Analysis of purity by SDS-PAGE and Western blotting using anti-His antibodies

The purified protein is typically stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What methods are most appropriate for analyzing the membrane association properties of Protein P3?

Given that Protein P3 is membrane-associated in the phage particle , several techniques can be employed to study its membrane interaction properties:

  • Lipid binding assays: Using liposomes composed of relevant lipids to assess binding affinity and specificity

  • Circular dichroism (CD) spectroscopy: To analyze secondary structure changes upon membrane interaction

  • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or labeled protein to monitor conformational changes

  • Differential scanning calorimetry (DSC): To assess thermal stability in presence and absence of membranes

  • Surface plasmon resonance (SPR): For real-time analysis of protein-membrane interactions

When designing these experiments, researchers should consider using lipid compositions that mimic the natural membrane environment of the protein in the phage particle.

How can crystallographic approaches be adapted for structural analysis of membrane-associated proteins like P3?

While direct crystallographic data for Protein P3 is not available in the provided search results, approaches similar to those used for the major capsid protein P2 could be adapted:

  • Detergent screening: Identify detergents that maintain protein solubility while allowing crystal formation

  • Lipid cubic phase crystallization: For proteins that require a lipid environment

  • Truncation strategies: Design constructs that remove highly flexible regions while preserving core structure

  • Co-crystallization with binding partners: If P3 interacts with other phage proteins, co-crystallization might stabilize its structure

  • Use of crystallization chaperones: Antibody fragments or nanobodies can stabilize flexible proteins

Researchers should monitor the orientation and positioning of P3 trimers or multimers in the asymmetric unit, as has been done for the P2 protein .

What experimental designs are effective for studying the role of P3 in phage assembly?

To study the role of Protein P3 in phage assembly, the following experimental approaches are recommended:

  • Transposon mutagenesis: Methods similar to those used for other PM2 genome analyses can be applied, where circular covalently closed genomic PM2 DNA is subjected to in vitro transposon insertion mutagenesis . This approach can identify essential regions of P3 for phage viability.

  • Deletion mutant analysis: Creating a series of deletion mutants can help identify functional domains, similar to approaches used for other viral capsid proteins . Researchers should focus on:

    • N-terminal deletions

    • C-terminal deletions

    • Internal domain deletions

  • Phage assembly assays: In vitro assembly systems can be developed to assess the role of P3 in virion formation, particularly its interaction with the lipid membrane.

  • Electron microscopy: Negative staining and cryo-EM can visualize structural changes in particles formed with wild-type versus mutant P3 proteins.

How can researchers assess the stability of structures formed by recombinant P3 protein?

Based on approaches used with other viral capsid proteins , the following methods can be employed to assess stability of P3-containing structures:

  • High salt concentration challenges: Exposing P3-containing structures to increasing concentrations of salts (e.g., MgCl₂) to determine the threshold for structural disruption

  • Thermal stability assays: Using differential scanning fluorimetry (DSF) to measure melting temperatures of P3 structures with various mutations

  • Limited proteolysis: To identify stable domains and flexible regions within the protein

  • Analytical ultracentrifugation: To assess the oligomeric state and stability of P3 assemblies

For example, in studies of other viral capsid proteins, core-like particles (CLPs) prepared from various deletion mutants showed differential sensitivity to disruption by high MgCl₂ concentrations, helping to identify regions crucial for stability .

How can computer modeling be used to predict critical interaction domains in Protein P3?

Advanced computational approaches can be applied to predict critical interaction domains in Protein P3:

  • Homology modeling: Based on structures of related proteins, particularly other membrane-associated bacteriophage proteins

  • Molecular dynamics simulations: To predict protein-membrane interactions and conformational changes under different conditions

  • Energy calculation of asymmetric dimers: Similar to approaches used for other viral capsid proteins, where total energies of interaction between asymmetric dimers were calculated to predict stability . This approach revealed that the amino-terminal regions of some viral capsid proteins contribute significantly to the energy of interaction between protein dimers.

  • Prediction of hydrogen bonds and salt bridges: Computational analysis can predict these important interactions that maintain protein structure and oligomerization, as demonstrated in studies of other viral capsid proteins where amino-terminal regions formed strong hydrogen bonds and salt bridges within protein dimers .

Protein TypeTotal Energy of Interaction (kcal/mol)Strong H-bondsStrong Salt BridgesReference
Full-length P3 (hypothetical)~200~15-20~10-15Based on
N-terminal deletion mutant (hypothetical)~150~10-12~5-8Based on
Extensive N-terminal deletion (hypothetical)<100<10<5Based on

What are the best approaches for studying potential protein-protein interactions between P3 and other phage structural components?

To study protein-protein interactions between P3 and other phage structural components, researchers can employ:

  • Pull-down assays: Using His-tagged recombinant P3 to capture potential binding partners from phage lysates

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between P3 and other phage proteins

  • Cross-linking mass spectrometry: To identify interaction interfaces between P3 and other proteins in the intact virion

  • Yeast two-hybrid or bacterial two-hybrid screening: To systematically test interactions with other phage proteins

  • FRET-based assays: Using fluorescently labeled proteins to monitor interactions in real-time

When designing these experiments, researchers should consider that the PM2 virion contains 10 virally encoded proteins , making it important to test interactions with all potential partners, particularly other membrane-associated proteins (P4-P10).

How can genome editing techniques be applied to study the function of Protein P3 in the context of the complete phage genome?

Advanced genome editing techniques can be applied to study Protein P3 function:

  • In vitro transposon mutagenesis: Similar to methods described for PM2 genome analysis , where:

    • Circular covalently closed genomic PM2 DNA is subjected to transposon insertion

    • Transposon-containing genomes are separated from wild-type genomes by preparative agarose gel electrophoresis

    • Mutant clones are verified by single-plaque purifications

    • DNA transfer into host cells (P. espejiana BAL-31) can be achieved by electroporation with yields of 5×10⁴ to 1×10⁵ PFU/μg PM2 DNA

  • Site-directed mutagenesis: To create specific mutations in the P3 gene to test hypotheses about structure-function relationships

  • Complementation studies: Using plasmid-expressed wild-type P3 to rescue mutant phenotypes

  • Recombineering approaches: For precise manipulation of the phage genome without leaving scars or markers

These approaches would allow researchers to study the effects of P3 mutations on phage infectivity, assembly, and stability in the context of the complete viral life cycle.

What strategies can address protein aggregation issues when working with recombinant Protein P3?

Given that P3 is a membrane-associated protein , aggregation is a common challenge. Researchers can employ these strategies:

  • Optimization of buffer conditions:

    • Test various pH values (typically 6.5-8.5)

    • Add mild detergents (e.g., 0.05-0.1% DDM, LDAO, or Triton X-100)

    • Include stabilizing agents (e.g., glycerol, trehalose as used in storage buffer )

    • Test different salt concentrations

  • Expression optimization:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Co-express with chaperones

    • Use fusion tags known to enhance solubility (MBP, SUMO, etc.)

  • Purification approaches:

    • Include detergents in all purification buffers

    • Perform size exclusion chromatography immediately after affinity purification

    • Consider on-column refolding approaches if inclusion bodies form

  • Storage considerations:

    • Store at high protein concentration (>1 mg/mL)

    • Add stabilizing agents as recommended in the storage buffer (Tris/PBS-based buffer with 6% trehalose, pH 8.0)

How can researchers distinguish between specific and non-specific effects when studying Protein P3 interactions with other molecules?

To distinguish between specific and non-specific interactions:

  • Control experiments:

    • Use unrelated proteins of similar size/charge as negative controls

    • Include competition experiments with unlabeled protein

    • Test binding under different salt/pH conditions (specific interactions often show distinct profiles)

  • Binding site mutations:

    • Create point mutations in predicted interaction interfaces

    • Specific interactions will be disrupted by targeted mutations

    • Non-specific interactions typically persist despite mutations

  • Quantitative binding assays:

    • Determine binding constants (Kd) using methods like SPR or ITC

    • Specific interactions typically show saturable binding with nanomolar to low micromolar Kd

    • Non-specific interactions often show linear, non-saturable binding

  • Structural validation:

    • Use structural techniques (X-ray crystallography, cryo-EM, NMR) to directly visualize interaction interfaces

    • Cross-linking mass spectrometry can identify specific contact residues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.