Recombinant Pseudoalteromonas phage PM2 Uncharacterized protein Gp-j (j)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
j; Uncharacterized protein Gp-j
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Pseudoalteromonas phage PM2 (Bacteriophage PM2)
Target Names
j
Target Protein Sequence
MGLFGGGNSKSTSNQTTNNENTNIATQGDNLGAVINGNGNSVTMTDHGLVDALVDIGGYM SDSTQAAFGAASDMAYSSTEFAGQAITDGFDYAEGVNRDSLDMAEGINRDSLNFGRDALS VTGDLMTDAMQYSSDAMLASIEGNAGLAGQVMDASTTMTGQSLNFGLDTFSGAMDSLNQS NNNMALLAEFTSNQSTDLARDSMAFGADLMAQYQDNISASNYDAREHMLDASKTAMQFAD NMSRSDGQQLAKDSNKTLMIGIVAVSAAVGLYAISKGVN
Uniprot No.

Target Background

Database Links

KEGG: vg:1262025

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is Pseudoalteromonas phage PM2 and what makes it significant in virology?

Pseudoalteromonas phage PM2 is a marine double-stranded DNA (dsDNA) bacteriophage and serves as the type virus of the family Corticoviridae. It is currently the only isolated member of this virus group . PM2 exhibits distinctive features including a highly supercoiled, circular dsDNA genome of approximately 10 kbp and a unique membrane structure residing under an icosahedral protein coat . The phage's significance lies in its unusual entry mechanism and membrane fusion process, which differs from better-characterized phages. Using comparative genomic approaches, researchers have identified putative corticoviral prophage elements in chromosomes from various aquatic bacteria of the phylum Proteobacteria, suggesting that PM2-like viruses are widespread in marine environments .

Which bacterial hosts can Pseudoalteromonas phage PM2 infect?

PM2 has a notably narrow host range. When screening multiple Pseudoalteromonas species, researchers found that only two strains could support PM2 replication: Pseudoalteromonas espejiana BAL-31 and Pseudoalteromonas sp. strain ER72M2 . This indicates that the receptor recognized by PM2 is not a common Pseudoalteromonas surface structure. Interestingly, other related strains such as Pseudoalteromonas sp. strain A28 and Pseudoalteromonas haloplanktis TAC125 cannot serve as hosts for PM2, further demonstrating its host specificity . This restricted host range makes PM2 a valuable model for studying highly specific virus-host interactions in marine environments.

What is known about the structural organization of the PM2 virion?

The PM2 virion has been extensively studied using cryoelectron microscopy and X-ray crystallography . The virion contains 10 virus-encoded protein species organized in a complex structure. The internal membrane is covered by a protein capsid composed of the major capsid protein P2 and receptor binding proteins. The trimeric capsid protein P2, featuring a double β-barrel motif, is organized on an icosahedral pseudo-T=21 lattice . Interestingly, the P2 fold is similar to that observed in phage PRD1, suggesting evolutionary relationships between different phage families. The virion has been successfully crystallized as an entire 45-MDa particle including the inner membrane and circular DNA, enabling detailed structural studies .

How does the PM2 phage penetrate the gram-negative bacterial cell envelope?

PM2 employs a fascinating and complex mechanism to deliver its 10-kbp genome across the cell envelopes of gram-negative Pseudoalteromonas species. The process begins with receptor recognition, followed by capsid disassembly and membrane fusion events . Specifically, the internal viral membrane fuses with the host's outer membrane in a poorly understood process. Research has shown that the membrane-associated protein P10 plays an essential role in this host cell penetration .

Adsorption studies reveal that PM2 binding to host cells is strictly aeration-dependent, with no virus binding detected in the absence of aeration . The adsorption rate constants differ between the two sensitive hosts: 1.4×10^-10 ml/min for ER72M2 and 2.2×10^-10 ml/min for BAL-31 . When studying this process, it's crucial to consider that no empty capsids are observed on the cell surface after infection, suggesting a complete disassembly of the capsid structure during entry .

What genetic manipulation techniques have been developed specifically for studying PM2 phage proteins?

Several sophisticated genetic tools have been developed to manipulate and study PM2 phage proteins:

  • Shuttle Vector System: Researchers isolated an autonomously replicating DNA element from P. haloplanktis TAC125 to construct shuttle vectors that can replicate in both E. coli and Pseudoalteromonas species . The vector cloneQ, carrying the replication origin from P. haloplanktis, the origin of replication from E. coli, and the origin of conjugative transfer (oriT), can successfully replicate in PM2 host bacteria without interfering with virus replication .

  • tRNA Suppressor System: A set of conjugative shuttle plasmids encoding tRNA suppressors for amber mutations has been developed. This system allows researchers to introduce and analyze nonsense mutations in PM2 . For example, researchers successfully isolated and characterized a suppressor-sensitive PM2 sus2 mutant deficient in structural protein P10 using this approach .

  • Site-Directed Mutagenesis: The PM2 genome has been engineered to include unique restriction enzyme cleavage sites (EcoRI, XbaI, SacI, and BamHI), facilitating targeted genetic modifications . This improved PM2 genome (named PM2V1) can be manipulated in sections, allowing for precise genetic engineering.

What methods are most effective for isolating and purifying Pseudoalteromonas phage PM2 for structural and functional studies?

For effective isolation and purification of PM2, researchers typically employ the following protocol based on the literature:

  • Phage Propagation: Infect sensitive host strains (BAL-31 or ER72M2) in marine-based growth medium under vigorous aeration, which is critical since PM2 adsorption is strictly aeration-dependent .

  • Radioactive Labeling (if needed): For tracking purposes, PM2 can be labeled with L-[35S]methionine added 10 minutes after infection or with 33P added 3 minutes prior to infection .

  • Purification by Rate Zonal Centrifugation: Following cell lysis, collect the released particles and purify them through a 5-20% sucrose gradient centrifugation . Purified PM2 particles will form a visible light-scattering zone in the gradient.

  • Membrane Separation: To isolate specific components (such as the lipid core), disrupt purified particles by freezing and thawing combined with EGTA treatment, then separate the lipid cores from soluble capsomers by differential centrifugation .

  • Quality Assessment: Determine the specific infectivity of purified particles (typically ~2.8×10^12 PFU/mg of protein for wild-type PM2) and analyze protein composition by SDS-PAGE followed by Coomassie blue staining .

This methodology allows for the isolation of highly pure and infectious PM2 particles suitable for downstream structural and functional analyses.

How can researchers generate and characterize nonsense mutations in PM2 structural proteins?

To generate and characterize nonsense mutations in PM2 structural proteins, researchers can follow this methodological approach:

  • Site-Directed Mutagenesis: Introduce amber (UAG) stop codons at specific positions within the target gene using PCR-based site-directed mutagenesis of the PM2 genome .

  • Cloning and Vector Construction: Clone the mutated genomic fragments into appropriate vectors (such as pSU18 or pSU19) and reconstruct the full-length mutated genome by ligation of the fragments .

  • Host System with Suppressor tRNAs: Transfer the mutated genome into Pseudoalteromonas host strains harboring plasmids encoding suppressor tRNAs (like pSM13 encoding suptRNA^Pro or pSM11 encoding suptRNA^His) .

  • Plaque Assay and Mutant Identification: Identify potential mutants by comparing plaque formation on suppressor-containing hosts versus wild-type hosts. True nonsense mutants will form plaques on suppressor strains but show reduced or no plaque formation on wild-type hosts .

  • Phenotypic Characterization: Analyze the protein composition of purified mutant particles using SDS-PAGE to confirm the absence or truncation of the target protein. Assess particle morphology and infectivity to determine the functional consequences of the mutation .

This approach has been successfully used to characterize PM2 sus2 mutants deficient in protein P10, revealing that while P10 is not essential for particle formation, it is critical for infectivity .

What are the key considerations for studying the adsorption and penetration of PM2 into host cells?

When studying PM2 adsorption and penetration, researchers should consider these methodological factors:

  • Aeration Conditions: PM2 adsorption is strictly aeration-dependent. No virus binding occurs without vigorous aeration, making this a critical parameter in experimental design .

  • Host Selection: The choice between BAL-31 and ER72M2 is important as they show different adsorption kinetics. The adsorption rate constants are 2.2×10^-10 ml/min and 1.4×10^-10 ml/min, respectively .

  • Appropriate Controls: Include PM2-resistant control cells (such as Pseudoalteromonas sp. strain A28, E. coli HB101, or spontaneous PM2-resistant mutants) to distinguish specific from non-specific binding .

  • Multiplicity of Infection (MOI): The relationship between MOI and adsorbed particles is not linear. At higher MOIs, the number of particles bound per cell plateaus, suggesting saturation of receptor sites .

  • Membrane Analysis: To study penetration mechanisms, monitor changes in the host cell's membrane potential and permeability using electrochemical measurements during infection .

  • Thin-Section Electron Microscopy: This technique can visualize virus particles interacting with the cell surface and capture the early stages of penetration .

  • Protein Tracking: Use radiolabeled phage particles (^35S or ^33P) to track the fate of specific viral components during the infection process .

By carefully controlling these parameters, researchers can accurately characterize the complex process of PM2 adsorption and entry into host cells.

How can researchers interpret conflicting data regarding PM2 protein function?

When facing conflicting data about PM2 protein function, researchers should employ this systematic approach:

  • Validation of Experimental Conditions: Ensure that host strains, growth conditions, and aeration parameters are consistent across experiments. For instance, PM2 adsorption is strictly aeration-dependent, and variations in aeration could lead to contradictory results .

  • Strain Verification: Confirm the identity and purity of both phage and bacterial strains. For bacterial hosts, total protein composition can be analyzed by SDS-PAGE to detect possible contaminating species .

  • Cross-Validation with Multiple Techniques: If results from genetic studies (e.g., nonsense mutations) conflict with biochemical analyses, employ orthogonal methods such as:

    • Functional complementation with wild-type protein

    • In vitro protein binding assays

    • Structural studies using cryoelectron microscopy or X-ray crystallography

  • Analysis of Pleiotropic Effects: Consider whether mutations in one protein might indirectly affect others. For example, in PM2 sus2 mutants, the absence of P10 resulted in non-infectious particles despite normal assembly, suggesting complex functional interactions .

  • Comparative Analysis: Compare results with related phages or similar proteins in other systems to identify potential functional analogies or evolutionary relationships .

  • Statistical Rigor: Ensure adequate biological and technical replicates, and apply appropriate statistical tests to determine the significance of observed differences.

By systematically analyzing conflicting data through these approaches, researchers can resolve discrepancies and develop a more coherent understanding of PM2 protein functions.

What are common technical challenges in working with PM2 phage, and how can they be addressed?

Researchers working with PM2 phage commonly encounter these technical challenges, along with effective solutions:

ChallengeCauseSolution
Poor phage adsorptionInsufficient aerationEnsure vigorous aeration during infection; PM2 adsorption is strictly aeration-dependent
Low transformation efficiencyRestriction barriers in Pseudoalteromonas hostsUse shuttle vectors derived from P. haloplanktis TAC125 plasmids that are compatible with host restriction systems
Difficulty distinguishing P10 from P2 in protein analysisSimilar mobility in SDS-PAGE (P10: 29 kDa, P2: 30.2 kDa)Separate the lipid core from capsid components before analysis; P10 associates with the lipid core while P2 is a capsid protein
Spontaneous phage-resistant mutantsReceptor modifications in host bacteriaIsolate and characterize multiple independent resistant mutants; verify electrochemical characteristics remain unchanged
Limited genetic tools for PseudoalteromonasLack of characterized repliconsUtilize the shuttle vector system based on the replicon from P. haloplanktis TAC125, which has been demonstrated to function in PM2 hosts
Variable plaque morphologySuppressor efficiency variationsWhen working with nonsense mutants, standardize the suppressor strain; different suppressor tRNAs (e.g., suptRNA^Pro vs. suptRNA^His) show different efficiencies

By anticipating these challenges and implementing the suggested solutions, researchers can significantly improve the reliability and reproducibility of their PM2 experiments.

What analytical approaches best reveal the structural and functional relationships between uncharacterized proteins like Gp-j and known PM2 components?

To elucidate relationships between uncharacterized proteins like Gp-j and known PM2 components, researchers should employ these analytical approaches:

  • Comparative Sequence Analysis: Use bioinformatics tools to identify sequence similarities between Gp-j and characterized proteins in PM2 or other phages. This may reveal conserved domains or motifs suggesting functional roles.

  • Structural Prediction and Modeling: Apply protein structure prediction algorithms to generate models of Gp-j, then compare these with the known structures of PM2 proteins such as the capsid protein P2, which has been characterized by X-ray crystallography .

  • Co-purification and Interaction Studies: Perform pull-down assays or co-immunoprecipitation to identify proteins that physically interact with Gp-j, potentially placing it within a functional complex.

  • Genetic Interaction Mapping: Create suppressor mutations or synthetic lethal/synthetic viable screens to identify genetic interactions between Gp-j and other PM2 genes, revealing functional relationships.

  • Localization Studies: Determine where Gp-j localizes within the virion or during different stages of infection using immunogold electron microscopy or fluorescently tagged versions of the protein.

  • Temporal Expression Analysis: Analyze when Gp-j is expressed during the infection cycle relative to other viral proteins using RT-PCR or RNA-seq, which can suggest functional groupings.

  • Targeted Mutations and Complementation: Generate specific mutations in Gp-j using the established PM2 genetic system with suppressor tRNAs, then test which PM2 functions are affected and whether these can be complemented by known proteins .

  • Membrane Association Analysis: Determine whether Gp-j associates with the viral membrane, similar to protein P10, by separating membrane components from capsid proteins after virion disruption .

By integrating data from these complementary approaches, researchers can develop testable hypotheses about the structural and functional role of uncharacterized proteins like Gp-j within the PM2 system.

What are the most promising future research directions for understanding PM2 phage and its uncharacterized proteins?

The most promising future research directions for PM2 phage include:

  • Comprehensive Proteome Characterization: Apply advanced proteomics techniques to fully characterize all 10 virus-encoded proteins, including uncharacterized proteins like Gp-j, determining their structural relationships and functional roles during different stages of infection.

  • Membrane Fusion Mechanisms: Further investigate the poorly understood process by which the PM2 internal membrane fuses with the host outer membrane, potentially revealing novel mechanisms of membrane fusion relevant to broader fields of virology and cell biology .

  • Host Range Determinants: Identify the specific receptors and genetic factors that determine the narrow host range of PM2, which could provide insights into bacterial surface structures and phage-host co-evolution in marine environments .

  • Environmental Distribution and Diversity: Expand on the identification of putative corticoviral prophage elements in aquatic bacteria to better understand the true diversity and ecological significance of PM2-like viruses in marine ecosystems .

  • Application of CRISPR-Cas Technology: Develop CRISPR-Cas genome editing systems compatible with Pseudoalteromonas to enable more precise genetic manipulation than the current suppressor tRNA approach, allowing for subtle mutations that don't completely eliminate protein expression.

  • Comparative Analysis with Related Phages: Deepen the structural and functional comparisons between PM2 and other phages like PRD1 that share similar protein folds but employ different infection strategies, potentially revealing evolutionary relationships between viral families .

  • Three-Dimensional Interactions: Build on the successful crystallization of the entire 45-MDa PM2 virion to develop comprehensive structural models of virus-host interactions during adsorption and penetration .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.