Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 1 (alkB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 1 (alkB1) is a genetically engineered enzyme central to the degradation of medium- to long-chain alkanes (C<sub>12</sub>–C<sub>24</sub>). Derived from the alkB1 gene locus (PA2574) in P. aeruginosa PAO1, this membrane-bound hydroxylase enables bacterial utilization of hydrocarbons as carbon sources. Its recombinant form has been extensively studied for bioremediation applications and microbial metabolic engineering .

Genomic Context

  • Locus: PA2574 on the P. aeruginosa PAO1 chromosome (2910729–2911877 bp, minus strand) .

  • Gene product: Alkane 1-monooxygenase (UniProtKB ID: ALKB1_PSEAE; RefSeq: NP_251264.1) .

  • Homologs: Found in 68 bacterial genera, with conserved operon structures in Pseudomonas spp. .

Table 3: alkB1 vs. alkB2 in P. aeruginosa

FeaturealkB1alkB2
Substrate RangeC<sub>12</sub>–C<sub>24</sub>C<sub>8</sub>–C<sub>16</sub>
Induction TimingLate exponential phase Early exponential phase
Oxygen AffinityHigher Lower
Role in Jet FuelEssential for C<sub>12</sub>+Broader initial degradation

Biotechnological Applications

  • Bioremediation: Critical for degrading petroleum hydrocarbons in contaminated environments .

  • Bioengineering: Used in recombinant Pseudomonas and Escherichia coli systems to enhance alkane metabolism .

  • Industrial relevance: Optimized strains degrade 70% of hexadecane within 15 days in marine conditions .

Challenges and Future Directions

  • Regulatory bottlenecks: Promoter polymorphisms (e.g., PAO1 vs. ATCC 33988) limit expression efficiency .

  • Synergistic pathways: Co-expression with almA (long-chain alkane hydroxylase) could expand substrate range .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
alkB1; PA2574; Alkane 1-monooxygenase 1; Alkane hydroxylase; AHs; Terminal alkane hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
alkB1
Target Protein Sequence
MFENFSPSTMLAIKKYAYWLWLLLALSMPFNYWMAQDSAHPAFWAFSLVIAVFGIGPLLD MLFGRDPANPDEETQTPQLLGQGYYVLLTLATVPVLIGTLVWAAGVFVAFQEWGWLGRLG WILSMGTVMGAVGIVVAHELIHKDSALEQAAGGILLAAVCYAGFKVEHVRGHHVHVSTPE DASSARFGQSVYQFLPHAYKYNFLNAWRLEAVRLRKKGLPVFGWQNELIWWYLLSLALLV GFGWAFGWLGMVFFLGQAFVAVTLLEIINYVEHYGLHRRKGEDGRYERTNHTHSWNSNFV FTNLVLFHLQRHSDHHAFAKRPYQVLRHYDDSPQMPSGYAGMVVLALIPPLWRAVMDPKV RAYYAGEEFQLTAEQSERPAAS
Uniprot No.

Target Background

Function
Catalyzes the hydroxylation of n-alkanes in the presence of a NADH-rubredoxin reductase and rubredoxin. It exhibits a preference for hydroxylating C16-C24 hydrocarbons.
Database Links

KEGG: pae:PA2574

STRING: 208964.PA2574

Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa Alkane 1-monooxygenase 1 (alkB1)?

Alkane 1-monooxygenase 1 (alkB1) is one of two alkane hydroxylase-encoding genes found in Pseudomonas aeruginosa that catalyzes the initial terminal oxidation of n-alkanes. The enzyme functions as part of a three-component system that includes a non-heme integral-membrane alkane hydroxylase (AlkB), rubredoxins (electron transfer proteins), and a rubredoxin reductase. This system is analogous to the well-characterized alkane degradation system in Pseudomonas putida GPo1, where AlkB works with rubredoxins (AlkF and AlkG) and rubredoxin reductase (AlkT) to hydroxylate alkanes . In P. aeruginosa, the alkB1 gene produces one of the key components needed for the organism to metabolize alkanes as carbon sources, particularly important in environments contaminated with petroleum hydrocarbons.

How does the alkB1 gene differ from alkB2 in P. aeruginosa?

The alkB1 and alkB2 genes in P. aeruginosa encode distinct alkane hydroxylases with different expression patterns and functional roles:

FeaturealkB1alkB2
RegulationAssociated with sigma 70 RNA polymerase Often more strongly induced by alkanes
Expression levelGenerally lower induction than alkB2 in response to alkanes Higher expression levels when exposed to alkanes
Promoter structureContains consensus boxes for vegetative σ70 RNA polymerase Different promoter architecture
Knockout impactReduces growth on alkanes but less dramatically than alkB2 knockout More significant reduction in growth and degradation rates on C16-C36 alkanes

While both genes contribute to alkane degradation capability, studies in related organisms like Rhodococcus sp. strain CH91 show that alkB2 often plays a more dominant role in long-chain n-alkane degradation compared to alkB1, as demonstrated by the relative impact of gene knockouts on growth rates and degradation efficiency .

What is the functional role of alkB1 in alkane degradation pathways?

The alkB1 gene encodes an enzyme responsible for the initial oxidation step in alkane degradation, specifically converting alkanes to alcohols. This critical first step overcomes the chemical inertness of alkanes by introducing oxygen, making them amenable to further metabolic processing.

The complete pathway involves:

  • Initial terminal oxidation of alkanes to primary alcohols (catalyzed by AlkB1)

  • Conversion of alcohols to aldehydes

  • Oxidation of aldehydes to fatty acids

  • Processing of fatty acids via β-oxidation to enter central metabolism

The alkB1 protein functions within a multicomponent system requiring electron transfer components. Experimental evidence shows that recombinant expression of alkB1 from organisms like Rhodococcus sp. strain CH91 can restore alkane degradation activity in alkB-deficient strains like Pseudomonas fluorescens KOB2Δ1, confirming its functional role in alkane metabolism . While alkB1 contributes to alkane degradation across a range of chain lengths, it often shows differential activity depending on the alkane substrate size, with some organisms showing preferences for specific carbon chain length ranges.

How is alkB1 expression regulated in P. aeruginosa?

The regulation of alkB1 in P. aeruginosa involves multiple mechanisms:

Understanding these regulatory mechanisms is crucial for manipulating alkB1 expression in recombinant systems and for optimizing alkane degradation processes.

What are the components of the alkane hydroxylase system involving alkB1?

The alkane hydroxylase system in P. aeruginosa that includes alkB1 functions as a three-component enzyme complex:

ComponentFunctionCharacteristics
AlkB1 (Alkane hydroxylase)Catalyzes the initial hydroxylation of alkanesIntegral membrane protein; contains non-heme iron
Rubredoxins (AlkG1/AlkG2)Electron transfer proteinsSmall iron-sulfur proteins; essential for electron transfer to AlkB1
Rubredoxin reductase (AlkT)Provides electrons to the rubredoxinsNAD(P)H-dependent; completes the electron transfer chain

These components work in concert to activate molecular oxygen and incorporate it into the alkane substrate. The system in P. aeruginosa RR1 contains genes homologous to those in P. aeruginosa PAO1, encoding both AlkB1 and AlkB2 alkane hydroxylases, the AlkG1 and AlkG2 rubredoxins, and the AlkT rubredoxin reductase . This arrangement is similar to the well-characterized alkane hydroxylase system in P. putida GPo1, which consists of AlkB, AlkF/AlkG (rubredoxins), and AlkT (rubredoxin reductase) . The rubredoxin and rubredoxin reductase components are essential for alkane hydroxylation by AlkB, serving as electron transfer elements required for the monooxygenase reaction .

What are the most effective methods for cloning and expressing recombinant alkB1 from P. aeruginosa?

Successful cloning and expression of recombinant alkB1 from P. aeruginosa requires careful consideration of several factors:

DNA Amplification and Cloning Strategy:

  • PCR amplification using primers targeting conserved regions of alkB1. Based on published protocols, primers can be designed to include necessary restriction sites (e.g., EcoRI, BamHI, NdeI, or HindIII) to facilitate cloning .

  • The full-length alkB1 gene should be amplified, including the coding region and potentially regulatory elements if native expression control is desired.

  • For Gibson assembly approaches, primers should include 15-25 bp overlaps with the target vector .

Vector Selection:

  • Expression vectors like pCom8 have been successfully used for heterologous expression of alkB genes .

  • For transcriptional studies, vectors like pUJ8 containing reporter genes (lacZ) allow for the construction of promoter fusions to study regulation .

  • For chromosomal integration, vectors such as pUT-mini-Tn5 derivatives can be employed .

Expression Host Considerations:

  • Heterologous expression in P. fluorescens KOB2Δ1 (an alkB1 deletion derivative) has proven effective for functional validation through complementation studies .

  • E. coli strains may be used for initial cloning, but functional expression often requires a bacterial host capable of providing the necessary electron transfer components (rubredoxin and rubredoxin reductase).

Expression Conditions:

  • Induction with appropriate alkanes (typically C12-C18) at concentrations of 0.1-1% (w/v or v/v) .

  • Culture conditions typically involve minimal media supplemented with the alkane substrate at temperatures around 30-37°C .

  • Growth monitoring by OD600 measurements over 1-3 weeks may be necessary to observe complete degradation patterns .

This methodology has been validated through successful expression studies showing that cloned alkB1 genes can restore alkane degradation activity in alkB-deficient strains .

How can researchers construct alkB1 knockout mutants in P. aeruginosa?

Construction of alkB1 knockout mutants in P. aeruginosa typically employs targeted gene deletion approaches:

Step-by-Step Methodology:

  • Design of deletion strategy:

    • Target substantial portions of the coding sequence for deletion while avoiding polar effects on downstream genes

    • For alkB1, strategies have successfully removed 354-355 amino acids out of ~380 total amino acids in the full-length protein

  • Construction of deletion vectors:

    • Create a suicide vector containing homologous sequences flanking the region to be deleted

    • Include selectable markers (e.g., antibiotic resistance) and counter-selectable markers (e.g., sacB)

  • Transformation and selection:

    • Transform the construct into P. aeruginosa via electroporation

    • Select for single crossover integrants using appropriate antibiotics

    • Counter-select for double crossover events on sucrose-containing media if using sacB-based systems

  • Verification of mutants:

    • PCR confirmation using primers flanking the deleted region

    • The size difference between wild-type and deletion mutant PCR products should correspond to the deleted fragment size

    • Sanger sequencing of the amplified region to confirm the precise deletion junctions

  • Construction of double mutants:

    • For alkB1/alkB2 double mutants, the established approach involves deleting alkB2 in an existing alkB1 deletion background

Phenotypic Verification:

  • Growth assays comparing wild-type and mutant strains on various alkanes as sole carbon sources

  • Use minimal media (e.g., M9) overlaid with appropriate alkane substrates (such as Jet A fuel)

  • Monitor growth at appropriate temperatures (e.g., 28°C) using OD600 measurements

This approach has been successfully implemented for creating alkB1, alkB2, and alkB1/alkB2 double mutants in P. aeruginosa ATCC 33988, resulting in strains with altered alkane degradation capabilities that can be used to elucidate the specific roles of each gene .

What experimental approaches can be used to measure alkB1 expression levels under different conditions?

Several complementary approaches can be employed to quantify alkB1 expression levels:

Transcriptional Analysis Methods:

  • RT-qPCR (Reverse Transcription Quantitative PCR):

    • Most direct and quantitative approach for measuring alkB1 transcript levels

    • Requires RNA extraction from cells grown under different conditions (e.g., various alkane substrates)

    • Enables comparison of relative expression levels between alkB1 and alkB2

    • Has shown that alkB2 is often more strongly induced than alkB1 in response to alkanes in organisms like Rhodococcus sp. strain CH91

  • Transcriptional Fusions:

    • Construction of promoter-reporter fusions (e.g., PalkB1::lacZ)

    • Involves PCR amplification of the promoter region (e.g., positions -336 to +10 relative to transcription start site)

    • Cloning into appropriate vectors containing reporter genes like lacZ

    • Integration into the genome using transposon-based systems like mini-Tn5

    • Allows measurement of promoter activity through β-galactosidase assays

  • Primer Extension Analysis:

    • Used to identify transcription start sites

    • Has been applied to map the alkB1 promoter in P. aeruginosa RR1

    • Reveals specific promoter elements that control gene expression

  • Flow Cytometry:

    • When combined with fluorescent reporter systems

    • Enables monitoring of gene expression at the single-cell level

    • Useful for assessing population heterogeneity in expression patterns

Protein-Level Analysis:

  • Western Blotting:

    • Requires specific antibodies against AlkB1

    • Provides direct measurement of protein levels

    • Can reveal post-transcriptional regulation mechanisms

  • Enzymatic Activity Assays:

    • Indirect measure of functional expression

    • Monitoring alkane degradation rates or oxygen consumption

    • Comparing wild-type, mutant, and complemented strains

Experimental Conditions to Test:

  • Carbon Source Variation:

    • Different chain-length alkanes (C7-C36)

    • Alternative carbon sources for catabolite repression studies

  • Growth Phase Monitoring:

    • Expression changes from exponential to stationary phase

    • P. aeruginosa RR1 shows growth phases with initial exponential growth until OD550 of ~1.2, followed by slower growth until OD550 of 5-6

  • Environmental Parameters:

    • Temperature, pH, oxygen availability

    • Presence of potential inhibitors or activators

These approaches have revealed that alkB1 expression is regulated by specific promoter elements and responds to alkane presence, with expression patterns that can differ significantly from those of alkB2 under identical conditions .

How does the substrate specificity of alkB1 compare with other alkane hydroxylases?

The substrate specificity of alkB1 differs significantly across various alkane hydroxylase systems:

Comparative Substrate Ranges:

Enzyme SystemOrganismPrimary Substrate RangeNotes
AlkB1 (P. aeruginosa)P. aeruginosaMedium to long-chain alkanesOften shows overlapping but distinct specificity from AlkB2
AlkB2 (P. aeruginosa)P. aeruginosaLong-chain alkanesGenerally more active on longer chains (C16-C36)
AlkB (P. putida GPo1)P. putidaC5-C12 alkanesWell-characterized system, narrower range
AlkMAcinetobacter sp. ADP1C12-C18 alkanesInduced by C7-C18 but growth only on >C12
AlkB1/AlkB2Rhodococcus sp. CH91C16-C36 alkanesBoth genes induced by long-chain alkanes

Key Observations on alkB1 Specificity:

Understanding these specificity differences is crucial for applications in bioremediation and biosensor development, as it helps predict which alkB variant might be most suitable for targeting specific hydrocarbon contaminants.

What are the challenges in heterologous expression of P. aeruginosa alkB1 in other bacterial hosts?

Heterologous expression of P. aeruginosa alkB1 faces several significant challenges:

Membrane Integration Issues:

  • AlkB1 is an integral membrane protein, requiring proper insertion into the host cell membrane for functionality.

  • Differences in membrane composition and protein translocation machinery between host organisms can impair correct folding and insertion.

  • Overexpression often leads to aggregation or inclusion body formation, reducing functional yield.

Electron Transfer Component Requirements:

  • AlkB1 functions as part of a three-component system requiring specific rubredoxins and rubredoxin reductase .

  • Host strains may lack compatible electron transfer proteins, necessitating co-expression of the complete system.

  • The stoichiometry between AlkB1 and electron transfer components must be optimized for maximum activity.

Expression Regulation Challenges:

  • Native promoters from P. aeruginosa may function differently in heterologous hosts due to differences in transcription machinery.

  • The AlkS regulatory system has specific binding sites and feedback mechanisms that may not translate across species .

  • Constitutive expression may be toxic to the host cell due to membrane disruption or oxidative stress from uncoupled catalytic activity.

Substrate Toxicity Issues:

  • Alkane substrates and oxidation products can be toxic to many bacterial hosts at concentrations needed for expression studies.

  • Two-phase culture systems with organic phase may be necessary but can complicate growth and protein expression.

  • The accumulation of alcohols from alkane oxidation may inhibit host cell growth.

Functional Validation Methods:

  • Restoration of alkane degradation in alkB-deficient strains like P. fluorescens KOB2Δ1 has proven effective .

  • Expression should be confirmed using growth complementation assays with alkanes as sole carbon sources.

  • Activity can be assessed by measuring the disappearance of alkane substrates and appearance of oxidation products using GC-MS.

Optimization Strategies:

  • Use of compatible hosts like Pseudomonas strains that naturally possess appropriate electron transfer components.

  • Codon optimization of the alkB1 sequence for the target host organism.

  • Expression under the control of inducible promoters that allow tight regulation of expression levels.

  • Co-expression with chaperones to assist proper folding and membrane integration.

These challenges have been partially addressed in successful heterologous expression studies using systems like pCom8 plasmids in P. fluorescens KOB2Δ1, which have demonstrated functional expression of alkB genes from various sources including Rhodococcus sp. strain CH91 .

How can researchers assess the functional activity of recombinant alkB1 in vitro and in vivo?

Assessing the functional activity of recombinant alkB1 requires multiple complementary approaches:

In Vivo Activity Assessment:

  • Growth Complementation Assays:

    • Expression of recombinant alkB1 in alkB-deficient strains like P. fluorescens KOB2Δ1

    • Monitor growth on minimal media with alkanes as sole carbon source

    • Compare growth curves (OD600) between strains containing empty vector (negative control) versus alkB1-expressing vector

    • Successful complementation indicates functional expression of alkB1

  • Whole-Cell Biotransformation:

    • Incubate alkB1-expressing cells with alkane substrates

    • Extract and analyze metabolites (alcohols, aldehydes)

    • Quantify using GC-MS or HPLC techniques

    • Calculate conversion rates and product distributions

  • Gene Expression Monitoring:

    • Construct reporter fusions (e.g., alkB1 promoter fused to lacZ)

    • Measure β-galactosidase activity under different conditions

    • Correlate expression levels with alkane degradation activity

    • Flow cytometry analysis for single-cell expression studies

In Vitro Activity Assessment:

  • Membrane Fraction Assays:

    • Isolate membrane fractions containing recombinant AlkB1

    • Add purified rubredoxin and rubredoxin reductase components

    • Provide NADH as electron donor

    • Measure substrate consumption or product formation

    • Oxygen consumption can be monitored using oxygen electrodes

  • Enzyme Kinetics Analysis:

    • Determine Km and Vmax values for different alkane substrates

    • Construct substrate specificity profiles

    • Compare kinetic parameters between wild-type and engineered variants

Analytical Methods for Activity Quantification:

  • Gas Chromatography-Mass Spectrometry (GC-MS):

    • Quantify residual alkanes after incubation periods

    • Detect and quantify oxidation products (alcohols, aldehydes)

    • Calculate conversion percentages and rates

    • Particularly useful for mixed alkane studies as conducted with Rhodococcus sp. CH91

  • Respirometry:

    • Measure oxygen consumption rates

    • Correlate with alkane oxidation activity

    • Useful for comparative studies between different alkB variants

  • Isotope Labeling:

    • Use 18O2 to confirm monooxygenase activity

    • Track incorporation of oxygen into alkane substrates

    • Distinguish between different oxidation mechanisms

These approaches have been successfully applied to characterize alkB genes from various sources, demonstrating their utility in functional assessment of recombinant alkB1 enzymes .

What bioinformatic approaches are useful for analyzing alkB1 sequences across different Pseudomonas strains?

Bioinformatic analysis of alkB1 sequences across Pseudomonas strains provides valuable insights into evolutionary relationships, functional conservation, and potential applications:

Sequence Analysis and Phylogenetics:

  • Multiple Sequence Alignment (MSA):

    • Align alkB1 sequences from diverse Pseudomonas strains

    • Identify conserved catalytic residues and structural motifs

    • Programs like MUSCLE, MAFFT, or Clustal Omega are commonly used

    • AlkB hydroxylases contain conserved histidine motifs essential for iron coordination

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using methods such as Maximum Likelihood or Bayesian inference

    • Compare alkB1 phylogeny with species phylogeny to detect horizontal gene transfer events

    • Examine clustering patterns that may correlate with substrate specificity

    • Similar approaches have been used for analyzing alkB diversity in Actinobacteria

Structural Analysis:

  • Protein Structure Prediction:

    • Generate homology models of AlkB1 proteins using tools like SWISS-MODEL or AlphaFold

    • Identify substrate-binding pockets and access channels

    • Compare structural features across variants with different substrate preferences

  • Molecular Docking:

    • Perform in silico docking of various alkane substrates

    • Predict binding affinities and orientations

    • Correlate structural differences with experimental substrate preferences

Genomic Context Analysis:

  • Operon Structure Examination:

    • Analyze genomic neighborhoods of alkB1 genes

    • Identify co-occurring genes for electron transfer components (rubredoxins, reductases)

    • Map regulatory elements and transcription factor binding sites

    • Compare with the well-characterized systems in P. putida GPo1 and A. borkumensis

  • Promoter Analysis:

    • Identify conserved regulatory motifs upstream of alkB1 genes

    • Search for binding sites of known regulators like AlkS

    • Examine σ70 consensus sequences as identified in P. aeruginosa RR1

Functional Prediction:

  • Substrate Specificity Prediction:

    • Correlate sequence variations with experimentally determined substrate ranges

    • Identify amino acid positions that might determine chain-length specificity

    • Use machine learning approaches to predict functional properties

  • Comparative Genomics:

    • Compare alkB1 and alkB2 genes within the same organism

    • Identify sequence features that differentiate these paralogs

    • Correlate with their differential expression patterns and functional roles

These bioinformatic approaches provide valuable guidance for experimental design, particularly for protein engineering efforts aimed at modifying substrate specificity or improving catalytic efficiency of alkB1 enzymes.

How do environmental factors affect alkB1 expression and activity?

Environmental factors significantly influence the expression and activity of alkB1, with important implications for both laboratory studies and environmental applications:

Growth Phase Effects:

  • Expression Dynamics:

    • alkB1 expression patterns change throughout bacterial growth phases

    • In A. borkumensis strains AP1 and SK2, expression of alkB1 and alkB2 decreased in stationary phase

    • P. aeruginosa RR1 shows distinct growth phases on alkanes, with an initial exponential phase until OD550 of ~1.2, followed by slower growth

  • Regulatory Mechanisms:

    • Transcription factors may have growth phase-dependent activity

    • Global regulators often modulate gene expression in response to growth phase transitions

Carbon Source and Catabolite Repression:

  • Substrate Induction:

    • n-Alkanes of appropriate chain lengths serve as inducers for alkB1 expression

    • Expression levels vary depending on alkane chain length

    • In Rhodococcus sp. strain CH91, alkB1 and alkB2 are induced by n-alkanes ranging from C16 to C36

  • Catabolite Repression:

    • Presence of preferred carbon sources can repress alkB1 expression

    • In P. putida GPo1, the AlkS regulatory system is subject to catabolite repression via Hfq and Crc proteins

    • This represents an additional layer of regulation beyond the direct induction by alkanes

Physical Environmental Parameters:

Environmental FactorImpact on alkB1Experimental Considerations
TemperatureAffects enzyme activity and expressionOptimal temperature for P. aeruginosa alkB1 expression often around 28-30°C
Oxygen AvailabilityCritical for monooxygenase functionMaintaining proper aeration in experimental systems is essential
pHInfluences protein stability and activityOptimal pH for activity may differ from optimal pH for expression
SalinityAffects membrane properties and enzyme functionImportant in environmental applications (e.g., marine oil spills)

Experimental Approaches to Study Environmental Effects:

  • Controlled Bioreactor Studies:

    • Maintain defined conditions while varying single parameters

    • Monitor expression using reporter systems (e.g., PalkB1::lacZ fusions)

    • Quantify activity through substrate degradation measurements

  • Field Studies:

    • Examine alkB1 expression in naturally contaminated environments

    • Use RT-qPCR to quantify mRNA levels under different conditions

    • Correlate expression with environmental parameters and degradation rates

  • Stress Response Integration:

    • Investigate how alkB1 expression integrates with general stress responses

    • Examine effects of oxidative stress, nutrient limitation, and other stressors

Understanding these environmental factors is crucial for optimizing recombinant expression systems and for predicting the effectiveness of bioremediation applications under varying field conditions. Research shows that even closely related alkane degradation systems can respond differently to environmental factors, highlighting the importance of characterizing each system independently .

What are the current limitations in studying alkB1 function and how might they be overcome?

Research on alkB1 faces several significant limitations that require innovative approaches to overcome:

Technical Challenges:

  • Membrane Protein Expression and Purification:

    • AlkB1 is an integral membrane protein, making purification difficult while maintaining activity

    • Solution Approach: Develop specialized detergent systems or nanodiscs for stabilization; use membrane fraction assays rather than purified protein approaches

  • Substrate Solubility Issues:

    • Poor water solubility of alkane substrates complicates activity assays

    • Solution Approach: Implement two-phase systems or use specialized solubilization techniques; standardize delivery methods using carrier solvents like octane for consistent exposure

  • Complex Three-Component System:

    • Activity requires coordinated function of AlkB1, rubredoxin, and rubredoxin reductase

    • Solution Approach: Co-express all components or develop reconstituted systems with defined component ratios; use electron donors like NADH at optimized concentrations

Methodological Limitations:

  • Functional Redundancy:

    • Presence of multiple alkane hydroxylases (alkB1, alkB2, others) with overlapping functions

    • Solution Approach: Generate single and multiple knockout strains; use heterologous expression in hosts lacking background activity, such as P. fluorescens KOB2Δ1

  • Regulatory Complexity:

    • Multiple layers of regulation including specific and global regulators

    • Solution Approach: Use promoter-reporter fusions to dissect specific regulatory elements; apply systems biology approaches to model integrated regulation

  • Detection Sensitivity:

    • Challenges in quantifying alkane degradation products at low concentrations

    • Solution Approach: Employ advanced analytical techniques like GC-MS/MS; develop more sensitive biosensor systems based on alkB1 regulatory elements

Knowledge Gaps:

  • Structure-Function Relationships:

    • Limited structural information on AlkB1 compared to other enzyme families

    • Solution Approach: Apply cryo-EM or crystallography techniques optimized for membrane proteins; use computational modeling integrated with site-directed mutagenesis

  • Substrate Range Determinants:

    • Incomplete understanding of what determines chain-length specificity

    • Solution Approach: Conduct systematic mutagenesis of residues lining the substrate-binding channel; perform comparative studies across naturally occurring variants

  • Regulatory Bottlenecks:

    • Discrepancies between inducer recognition range and substrate oxidation range

    • Solution Approach: Decouple expression from native regulation using controlled expression systems; engineer regulatory proteins with altered inducer specificity

Future Directions:

  • Synthetic Biology Approaches:

    • Develop standardized expression platforms for alkB1 characterization

    • Create biosensors using alkB1 regulatory elements for environmental monitoring

    • Design artificial alkane degradation pathways with optimized component integration

  • Advanced Imaging Techniques:

    • Apply single-molecule approaches to study real-time alkane hydroxylation

    • Use localization microscopy to examine membrane distribution and organization of AlkB1

  • Systems Biology Integration:

    • Model alkB1 function within the broader context of cellular metabolism

    • Examine metabolic flux alterations during growth on different alkane substrates

These approaches can help overcome current limitations and advance our understanding of alkB1 function, ultimately leading to improved applications in bioremediation and biotechnology.

How can alkB1 be engineered for enhanced activity or altered substrate specificity?

Engineering alkB1 for improved properties requires strategic approaches targeting key aspects of the enzyme's structure and function:

Rational Design Approaches:

  • Active Site Engineering:

    • Identify residues lining the substrate-binding channel using homology models or crystal structures

    • Target conserved histidine motifs known to coordinate iron while preserving catalytic function

    • Modify residues that determine chain-length specificity through site-directed mutagenesis

    • Examples could include expanding the substrate tunnel to accommodate larger alkanes or restricting it for improved specificity

  • Membrane Integration Optimization:

    • Modify transmembrane regions to improve stability in heterologous hosts

    • Engineer the protein-lipid interface to enhance folding efficiency and reduce aggregation

    • Consider fusion tags that facilitate membrane insertion while preserving activity

  • Electron Transfer Enhancement:

    • Improve interactions with electron transfer partners (rubredoxins)

    • Engineer direct fusion constructs linking AlkB1 with its electron transfer components

    • Optimize the stoichiometry between AlkB1 and electron transfer components

Directed Evolution Strategies:

  • Library Generation Methods:

    • Error-prone PCR to create random mutations throughout the alkB1 gene

    • DNA shuffling between alkB1 variants from different species

    • Targeted saturation mutagenesis of specific regions identified through comparative analysis

  • Selection/Screening Approaches:

    • Growth-based selection using alkanes of interest as sole carbon sources

    • High-throughput colorimetric assays to detect alcohol production

    • Biosensor systems that couple alkane oxidation to reporter gene expression

    • Flow cytometry-based screening for single-cell analysis of activity

Regulatory Engineering:

  • Expression Enhancement:

    • Optimize promoter elements based on the characterized PalkB1 promoter structure

    • Modify or replace native regulators like AlkS to alter induction patterns

    • Remove regulatory bottlenecks that limit expression under certain conditions

  • Synthetic Biology Frameworks:

    • Develop standardized expression modules for alkB1 with well-characterized parts

    • Create tunable systems allowing precise control of expression levels

    • Design synthetic operons that coordinate expression of all system components

Experimental Design for Engineering Projects:

Engineering GoalApproachValidation Method
Broader substrate rangeTarget residues lining substrate channelGC-MS analysis of degradation of diverse alkanes
Enhanced activityImprove electron transfer efficiencyOxygen consumption and product formation rates
Altered regioselectivityModify active site geometryAnalysis of hydroxylation position on alkane substrate
Improved stabilityEnhance membrane integrationActivity retention after extended incubation periods
Temperature toleranceTarget flexible regions for stabilizationActivity assays at elevated temperatures

Case Study Lessons:
Studies on Rhodococcus sp. strain CH91 demonstrate that naturally occurring alkB variants (alkB1 and alkB2) show different activities toward C16-C36 n-alkanes, with alkB2 playing a more significant role . These natural variations provide valuable insights for engineering efforts, suggesting specific regions and residues that might determine substrate preference and catalytic efficiency. Similarly, comparative analysis of regulatory systems across species reveals potential targets for engineering improved expression control .

Successful engineering would produce alkB1 variants with enhanced activity toward specific target alkanes, improved stability for industrial applications, or novel regiospecificity for producing value-added products from alkane substrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.