Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 2 (alkB2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pseudomonas aeruginosa Alkane 1-monooxygenase 2 (AlkB2) is a genetically engineered enzyme derived from the alkB2 gene, which encodes a membrane-bound hydroxylase critical for the degradation of medium- to long-chain alkanes (C8–C20). This enzyme catalyzes the initial step of alkane oxidation, converting alkanes into primary alcohols for subsequent β-oxidation. AlkB2 is a key component in bioremediation and microbial fuel degradation due to its broad substrate specificity and regulatory flexibility .

Substrate Specificity

AlkB2 exhibits a broader substrate range compared to its homolog AlkB1:

Substrate RangeAlkB1AlkB2
Short-chain (C6–C12)NoYes (C8–C12)
Medium-chain (C12–C16)YesYes
Long-chain (C16–C20)NoYes
Data derived from growth assays and gene deletion studies .

Regulatory Mechanisms

  • CrgA Repression: The LysR-family transcriptional regulator CrgA binds to the alkB2 promoter, inhibiting transcription until metabolic intermediates (e.g., hexadecyl-CoA) displace it .

  • Growth Phase Dependency: alkB2 is induced during early exponential growth, while alkB1 activates later, ensuring metabolic flexibility .

Expression and Purification

Recombinant AlkB2 is typically expressed using plasmid vectors (e.g., pET-21a+) in E. coli BL21(DE3) . Key parameters include:

ParameterDetail
Expression HostE. coli BL21(DE3)
InductionIPTG (0.5 mM)
Protein Yield~1.2 mg/L culture
PurificationNickel-affinity chromatography
Storage-20°C (short-term), -80°C (long-term)

Catalytic Efficiency

  • AlkB2 hydroxylates C8–C20 alkanes with higher activity than AlkB1, particularly for C12–C16 substrates .

  • In P. aeruginosa ATCC 33988, deletion of alkB2 abolishes growth on C8–C10 alkanes, while alkB1 mutants retain partial activity on C12–C16 .

Transcriptional Dynamics

  • Promoter Polymorphism: SNPs in the alkB2 promoter enhance its expression in hydrocarbon-adapted strains (e.g., ATCC 33988 vs. PAO1) .

  • Co-regulation with Efflux Pumps: AlkB2 induction coincides with efflux pump activation, linking alkane degradation to antibiotic resistance .

Applications

  1. Bioremediation: AlkB2-engineered strains degrade jet fuel (C8–C16 alkanes) 2–3× faster than wild-type P. aeruginosa .

  2. Industrial Biotechnology: Recombinant AlkB2 is used to optimize microbial cell factories for biofuel production .

  3. Environmental Monitoring: Serves as a biomarker for hydrocarbon contamination in soil and water .

References

  1. Metabolic characterization of alkane monooxygenases (2025) .

  2. Differential expression of alkane hydroxylases in P. aeruginosa (2003) .

  3. CrgA-mediated repression of AlkB2 (2019) .

  4. Transcriptomic adaptation in hydrocarbon-degrading Pseudomonas (2017) .

  5. Genomic analysis of P. aeruginosa GOM1 (2019) .

  6. Recombinant AlkB2 product specifications (Cusabio) .

  7. Cloning and expression of alkB in E. coli (2020) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
alkB2; PA1525; Alkane 1-monooxygenase 2; Alkane hydroxylase; AHs; Terminal alkane hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
alkB2
Target Protein Sequence
MFASLSSAWMLRLKKYGYWIWLIAVLGIPLSYWWSLGSDYPNAWPWLVISVVFGLIPILD AIVGRDPANPEEASEVPEMEAQGYYRVLSLATVPLLLGMLVWSGWILAHETRWDWVGQLG WILSVGTVMGAIGITVSHELIHKDPQLEQNAGGLLLAAVCYAGFKVEHVRGHHVHVSTPE DASSSRYGQSLYSFLPHAYKHNFLNAWRLEAERLKRKGLPALHWRNELIWWYAISALFLL GFSLAFGWLGAIFFLGQSVMAFTLLEIVNYVEHYGLHRRRLDNGRYERTTPEHSWNSNFL LTNLFLFHLQRHSDHHAYAKRRYQVLRHYDSSPQLPNGYAGMIVLALFPPLWRAVMDPKV RAYYAGEEYQLTDTQRI
Uniprot No.

Target Background

Function
Catalyzes the hydroxylation of n-alkanes in the presence of NADH-rubredoxin reductase and rubredoxin. It exhibits a preference for hydroxylating C12-C20 hydrocarbons.
Database Links

KEGG: pae:PA1525

STRING: 208964.PA1525

Protein Families
Fatty acid desaturase type 1 family, AlkB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of alkB2 in Pseudomonas aeruginosa?

Alkane 1-monooxygenase 2 (alkB2) is a critical enzyme in P. aeruginosa that catalyzes the initial oxidation step in alkane degradation. Research demonstrates that alkB2 functions as part of an early response mechanism when cells are exposed to hydrocarbon substrates. Studies with P. aeruginosa ATCC 33988 (originally isolated from a jet fuel tank) show that alkB2 expression is induced earlier than alkB1 when the organism encounters alkanes, indicating its primary role in the initial response to hydrocarbon exposure .

The enzyme is essential for normal alkane utilization, as deletion of both alkB1 and alkB2 genes completely inhibits P. aeruginosa ATCC 33988 growth in jet fuel. This suggests that these two alkane monooxygenases are jointly responsible for the degradation of alkanes found in hydrocarbon mixtures such as jet fuel . The expression pattern and substrate range of alkB2 contribute significantly to the organism's ability to thrive in hydrocarbon-contaminated environments and effectively degrade these compounds.

How does the substrate range of alkB2 compare to alkB1?

Experimental evidence reveals distinct substrate specificity profiles between alkB1 and alkB2 enzymes. AlkB2 demonstrates a broader substrate range (n-C8-n-C16) compared to AlkB1, which is limited to longer chain alkanes (n-C12-n-C16) . This differential substrate specificity has significant implications for the organism's adaptive capabilities in various hydrocarbon environments.

Additionally, the growth of alkB2 mutant strains on n-C16 was significantly attenuated compared to the wild type or the alkB1 mutant strains, suggesting that alkB2 also contributes substantially to the degradation of longer chain alkanes, even when alkB1 is present . These substrate range differences highlight the complementary roles of these two enzyme systems.

What techniques are used to create and study recombinant alkB2 in P. aeruginosa?

Researchers employ several sophisticated molecular techniques to create and study recombinant alkB2 systems:

  • Homologous recombination systems such as pRKaraRed have proven effective for generating alkB2 knockout mutants. This approach involves a two-step recombination process to create in-frame scarless gene deletions .

  • The methodology typically follows this procedure:

    • Transformation of pRKaraRed into P. aeruginosa to generate competent cells

    • Amplification of sacB-bla cassettes from plasmid pEX18Ap using specific primer pairs

    • Electro-transformation into the competent cells

    • Selection on appropriate antibiotic-containing media

    • Second recombination step using sacB-bla removal cassettes

    • Verification by PCR detection and DNA sequencing

  • For expression analysis, researchers employ quantitative reverse transcriptase PCR (RT-qPCR) to monitor alkB2 gene expression under various conditions, especially in response to different hydrocarbon substrates .

  • Electrophoretic mobility shift assay (EMSA) has been used to study regulatory mechanisms, particularly to verify DNA-protein interactions between transcriptional regulators like GntR and the alkB2 promoter region .

These methodological approaches allow for detailed characterization of alkB2 function, regulation, and its role in alkane degradation pathways.

How is alkB2 expression regulated in response to hydrocarbon exposure?

The regulation of alkB2 expression involves sophisticated genetic control mechanisms that respond to environmental conditions. Studies show that alkB2 induction happens earlier than alkB1 when P. aeruginosa cells are exposed to alkanes, suggesting different regulatory controls for these two genes .

A key regulator of alkB2 is the GntR transcriptional regulator (gene RS18845), which is located upstream of alkB2 (RS18850). Transcriptome analyses of wild-type and alkB2 knockout strains grown on eicosane (C20 n-alkane) revealed that GntR was significantly upregulated, indicating its involvement in alkB2 regulation .

Further experimental evidence from RT-qPCR studies demonstrated that in GntR mutant strains, alkB2 expression became constitutive and independent of eicosane presence. In contrast, when GntR was produced, alkB2 expression was significantly induced by the alkane substrate . This indicates that GntR functions as a substrate-responsive transcriptional regulator for alkB2.

EMSA analysis identified a specific palindromic DNA motif (5′‐ATTGTCAGACAAT‐3′) that is recognized by GntR, providing the molecular basis for this regulation . This regulatory mechanism allows P. aeruginosa to finely tune its alkane degradation capabilities in response to environmental conditions.

What is the relationship between alkB2 and hydrocarbon degradation capacity?

The presence and functionality of alkB2 significantly impact the hydrocarbon degradation capacity of P. aeruginosa strains. Research with P. aeruginosa ATCC 33988 demonstrates that alkB2 is essential for the degradation of medium-chain alkanes (C8-C10) and contributes substantially to the degradation of longer-chain alkanes (C12-C16) .

Growth studies with genetically defective mutants lacking both alkane hydroxylase genes (alkB1 and alkB2) showed complete inability to degrade any normal alkanes (n-C6-n-C18) as sole carbon sources . This confirms the critical role of these enzymes in hydrocarbon metabolism.

Interestingly, the degradation rate of n-C12 or n-C16 alkanes by alkB2 mutants was slower compared to alkB1 mutants, suggesting that AlkB2 monooxygenase has higher enzymatic activity compared to AlkB1 . This higher activity likely contributes to the competitive advantage of certain P. aeruginosa strains in hydrocarbon-rich environments.

The distribution of alkB2 across different P. aeruginosa strains also correlates with their hydrocarbon degradation capabilities. Studies of strains isolated from petroleum-contaminated environments in Morocco showed that those carrying alkB genes similar to P. aeruginosa PAO1's alkB1 and alkB2 exhibited enhanced abilities to grow on a wide range of n-alkanes .

What methodologies are effective for creating alkB2 knockout mutants?

Creating precise alkB2 knockout mutants requires sophisticated genetic manipulation techniques. The pRKaraRed homologous recombination system has proven particularly effective for generating in-frame scarless knockout mutants in P. aeruginosa. The detailed methodology follows a two-step process:

First step:

  • Electro-transformation of plasmid pRKaraRed into the target P. aeruginosa strain

  • Amplification of sacB-bla cassettes from plasmid pEX18Ap using specific primer pairs (F1 and R1)

  • Electro-transformation of these cassettes into the prepared SJTD-1/pRKaraRed competent cells

  • Selection of transformants on LB plates containing 500 μg/mL carbenicillin and 50 μg/mL tetracycline

Second step:

  • Amplification of sacB-bla removal cassettes from the genomic DNA of first-step colonies using primer pairs F2 and R2

  • Electro-transformation into the competent cells from the first step

  • Selection on LB plates with 10% sucrose and 50 μg/mL tetracycline

  • Further parallel selection on plates with and without carbenicillin to identify positive recombinants (SucRCarbS)

  • Verification by PCR detection with test primers and DNA sequencing

For multiple gene deletions (such as creating alkB1/alkB2 double mutants), this two-step knockout method can be repeated sequentially. This methodology allows for precise genetic manipulation without introducing marker genes or other unwanted modifications into the genome, providing clean genetic backgrounds for functional studies of alkB2.

How does GntR regulate the expression of alkB2?

The GntR transcriptional regulator plays a critical role in controlling alkB2 expression through a sophisticated molecular mechanism. Transcriptome analysis of wild-type and alkB2 knockout strains revealed that the transcriptional regulator gene gntR (RS18845), located upstream of alkB2 (RS18850), was significantly upregulated during growth on eicosane (C20 n-alkane) .

The molecular mechanism of this regulation was further elucidated through electrophoretic mobility shift assay (EMSA) experiments. These studies verified that GntR recognizes and binds to a specific palindromic DNA motif (5′‐ATTGTCAGACAAT‐3′) in the regulatory region of alkB2 . The presence of this DNA recognition sequence provides the molecular basis for GntR's direct control of alkB2 transcription.

This regulatory system allows P. aeruginosa to finely tune its alkane degradation capabilities in response to environmental conditions, activating alkB2 expression when appropriate substrates are available and maintaining tight control over this metabolic pathway when not needed.

What experimental designs can effectively measure alkB2 enzyme activity?

Measuring alkB2 enzyme activity requires specialized experimental approaches that can distinguish its function from other monooxygenases. Effective experimental designs include:

Growth characterization on different alkane substrates:

  • Culture wild-type, alkB1 mutant, alkB2 mutant, and double mutant strains on minimal media with different n-alkanes (C6-C18) as sole carbon sources

  • Monitor growth rates and final cell densities to assess the relative contributions of each enzyme to alkane utilization

  • Compare growth curves to identify substrate preferences and enzyme efficiencies

Gene expression analysis:

  • Use RT-qPCR to quantify alkB2 expression levels under various conditions

  • Compare expression in response to different alkane chain lengths

  • Analyze expression timing to determine the temporal patterns of induction

  • Examine co-expression of alkB2 with other genes in the alkane degradation pathway

Alkane degradation rate measurements:

  • Quantify the disappearance of specific alkanes from culture media using gas chromatography

  • Calculate degradation rates for wild-type versus alkB1 and alkB2 mutants

  • Determine substrate-specific activities by comparing degradation efficiencies across different chain lengths

Protein purification and in vitro activity assays:

  • Express recombinant alkB2 with appropriate tags for purification

  • Develop in vitro assay systems with various alkane substrates

  • Measure oxygen consumption or product formation rates

  • Determine kinetic parameters (Km, Vmax) for different substrates

How do environmental conditions affect alkB2 expression and function?

The expression and function of alkB2 are significantly influenced by environmental conditions, particularly the presence of hydrocarbon substrates. Research has revealed several key aspects of this environmental responsiveness:

Substrate-induced expression:
alkB2 gene expression is induced in a growth-dependent manner when P. aeruginosa is exposed to alkanes. Importantly, alkB2 induction occurs earlier than alkB1, indicating its role in the initial response to hydrocarbon exposure . This temporal pattern suggests a sequential activation strategy that may optimize resource allocation during adaptation to hydrocarbon substrates.

Carbon chain length specificity:
The expression and activity of alkB2 vary depending on the carbon chain length of available alkanes. AlkB2 has a broader substrate range (n-C8-n-C16) compared to AlkB1 (n-C12-n-C16), suggesting environmental adaptation to different hydrocarbon profiles .

Phenotypic diversity:
Exposure to hydrocarbons induces heterogeneity and phenotypic diversity within P. aeruginosa populations. Different phenotypic subsets emerge within the same genotype when influenced by hydrocarbon stress, suggesting that environmental conditions drive adaptive diversification through differential alkB2 expression and function .

This environmental responsiveness allows P. aeruginosa to efficiently adapt to hydrocarbon-rich environments, optimizing its metabolic capabilities based on the specific composition of available substrates.

How can researchers distinguish between alkB1 and alkB2 activities in experimental settings?

Gene-specific knockout strains:
Creating single gene knockouts (ΔalkB1 or ΔalkB2) and double knockouts (ΔalkB1ΔalkB2) provides the most direct approach to distinguish their activities. By comparing phenotypes and growth characteristics across these mutant strains, researchers can attribute specific functions to each enzyme .

Chain-length specific substrate tests:
Since AlkB2 has a broader substrate range (n-C8-n-C16) compared to AlkB1 (n-C12-n-C16), growth tests using different chain-length alkanes can distinguish their activities:

  • Growth on C8-C10 alkanes is exclusively dependent on alkB2

  • Growth on C12-C16 involves both enzymes, with different efficiencies

  • Comparing degradation rates on these different substrates can quantify the relative contributions of each enzyme

Gene expression analysis:
RT-qPCR can monitor the differential expression patterns of alkB1 and alkB2 under various conditions. This approach reveals temporal differences in their activation (alkB2 is induced earlier than alkB1) and can correlate expression levels with substrate utilization rates .

Specific PCR amplification:
Using gene-specific primers designed to distinguish between alkB1 and alkB2 sequences allows for detection and quantification of each gene in environmental samples or culture studies. This approach has been used to correlate the presence of specific alkB genes with hydrocarbon degradation capabilities in environmental isolates .

What are the evolutionary implications of alkB2's role in alkane degradation?

The evolution of alkB2 and its distinctive role in alkane degradation has significant implications for understanding bacterial adaptation to hydrocarbon-rich environments:

Gene duplication and specialization:
The presence of two distinct alkane monooxygenases (alkB1 and alkB2) with different substrate preferences in P. aeruginosa likely resulted from gene duplication followed by functional divergence. This evolutionary pattern has allowed specialized roles to develop, with alkB2 adapting to handle a broader range of alkanes (n-C8-n-C16) compared to alkB1 (n-C12-n-C16) .

Adaptive significance:
The broader substrate range of alkB2 provides a clear adaptive advantage in environments containing diverse hydrocarbon mixtures, such as petroleum-contaminated sites. P. aeruginosa strains carrying functional alkB2 genes would have expanded metabolic capabilities, allowing them to utilize a wider range of carbon sources .

Strain-specific distribution:
Studies of P. aeruginosa strains isolated from petroleum-contaminated environments show variation in their alkB gene profiles. Some strains carry alkB genes similar to those of P. aeruginosa PAO1 (alkB1 and alkB2), while others show additional alkB variants similar to those found in other species like P. putida GPo1. This diversity suggests ongoing evolutionary processes including possible horizontal gene transfer events .

Environmental selection:
The correlation between alkB gene profiles and hydrocarbon degradation capabilities indicates strong environmental selection. For example, only strains carrying specific alkB variants could utilize C6-C10 n-alkanes, demonstrating the direct link between genetic composition and adaptive metabolic capabilities .

These evolutionary aspects highlight how environmental pressures have shaped the alkane degradation systems in P. aeruginosa, leading to specialized enzyme systems that optimize resource utilization in hydrocarbon-rich niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.