KEGG: pap:PSPA7_1124
Apolipoprotein N-acyltransferase (lnt) is an essential membrane-bound enzyme in Pseudomonas aeruginosa that catalyzes the final step in bacterial lipoprotein maturation. This 57-kDa protein converts diacylated bacterial lipoproteins (DA-BLPs) to triacylated bacterial lipoproteins (TA-BLPs) using glycerophospholipids as acyl donors . The conversion prepares bacterial lipoproteins for trafficking to the outer membrane and affects their recognition by Toll-like receptors of the innate immune system .
The enzyme operates through a ping-pong mechanism involving a catalytic triad consisting of residues equivalent to E267, K335, and C387 (using E. coli numbering) . This reaction is critical for bacterial viability, making lnt an attractive target for antibiotic development since it has no equivalent in humans .
The lnt protein belongs to the CN hydrolase family and contains multiple transmembrane domains with a complex structure that includes flexible arms believed to participate in substrate binding and release . In P. aeruginosa strain LESB58, the lnt protein is encoded by the gene designated as PLES_09911 and consists of 511 amino acids in its full-length form .
The structural characterization of Apolipoprotein N-acyltransferase (lnt) reveals a complex membrane-bound enzyme with distinct functional domains:
Lnt possesses a catalytic triad consisting of E267, K335, and C387 (E. coli numbering) that forms the core of the active site . Recent structural studies using X-ray crystallography and cryo-electron microscopy have provided snapshots of the enzyme in different states during the reaction cycle, validating the proposed ping-pong mechanism . These studies identified a single active site that evolved to bind substrates sequentially, positioning their reactive parts adjacent to the catalytic triad .
The protein contains hydrophobic transmembrane regions that anchor it to the membrane, with the catalytic domain oriented toward the periplasmic space . Four residues have been identified as absolutely required for lnt function: Y388 and E389, which are part of the hydrophobic pocket constituting the active site, and W237 and E343, which are located on flexible arms that face away from the active site . These flexible arms are believed to open and close upon binding and release of phospholipid and/or apolipoprotein substrates .
The full amino acid sequence of P. aeruginosa lnt (strain LESB58) has been determined (UniProt: B7V9D2) and includes distinctive regions like MRWISRPGWPGHLLALAAGALTPLALAPFDYWPLAILSIALLYLGLRGLPGKSALWRGWW at the N-terminus, which forms part of the membrane-anchoring domain . The protein is officially named Apolipoprotein N-acyltransferase with the EC classification 2.3.1.- .
This structural information provides a foundation for understanding the enzyme's mechanism and has implications for drug design targeting this essential bacterial protein.
Apolipoprotein N-acyltransferase (lnt) catalyzes the N-acylation of diacylated lipoproteins through a ping-pong mechanism that involves sequential binding of substrates at a single active site. The detailed catalytic process includes:
The reaction begins when a glycerophospholipid substrate binds to the enzyme's active site . The catalytic triad (E267, K335, C387 in E. coli numbering) facilitates the transfer of an acyl chain from the glycerophospholipid to form a thioester intermediate with the catalytic cysteine (C387) . This first half-reaction results in the formation of a covalent acyl-enzyme intermediate and the release of the lyso-phospholipid from the active site .
In the second half-reaction, the diacylated lipoprotein substrate binds to the enzyme, and the acyl chain is transferred from the enzyme's catalytic cysteine to the α-amino group of the conserved cysteine residue in the lipoprotein . This results in the formation of a triacylated lipoprotein, which is then released from the enzyme .
X-ray crystallography and cryo-electron microscopy studies have charted the structural changes that occur during the reaction cycle . The enzyme's active site has evolved to bind structurally diverse substrates by recognizing general structural and chemical criteria rather than specific sequences . This explains the substrate promiscuity observed with lnt enzymes.
Beyond the catalytic triad, additional residues play crucial roles in the reaction. Y388 and E389 form part of the hydrophobic pocket constituting the active site, while W237 and E343 are located on flexible arms that participate in substrate binding and release . Site-directed mutagenesis studies have confirmed these residues as absolutely required for lnt function .
This ping-pong mechanism efficiently couples the two half-reactions and allows the enzyme to process a variety of substrates, contributing to the versatility of lipoprotein modification in bacterial systems.
Apolipoprotein N-acyltransferase (lnt) contains several key conserved residues that are critical for its enzymatic function. These residues have been identified through sequence analysis, site-directed mutagenesis, and structural studies:
The enzyme possesses a catalytic triad consisting of E267, K335, and C387 (E. coli numbering) . This triad forms the core of the active site and is absolutely required for enzymatic activity . The catalytic cysteine (C387) serves as the nucleophile that forms the thioester intermediate with the acyl chain from the phospholipid donor . E267 likely functions to activate this cysteine, while K335 helps position substrates and stabilize reaction intermediates .
Y388 and E389 form part of the hydrophobic pocket that constitutes the active site . These residues are absolutely required for lnt function and directly affect the modification of bacterial lipoproteins . They likely play roles in substrate recognition and positioning within the active site.
W237 and E343 are located on two flexible arms that face away from the active site . These residues are expected to open and close upon the binding and release of phospholipid and/or apolipoprotein substrates . Their conservation and essential nature suggest they play critical roles in substrate interaction and enzyme dynamics during the catalytic cycle.
Lnt proteins from proteobacteria, including P. aeruginosa, are functionally conserved and can complement E. coli lnt mutants in vivo . The essential residues identified in E. coli lnt are conserved in these functional homologs, suggesting a shared catalytic mechanism . Interestingly, lnt proteins from actinomycetes cannot complement E. coli lnt, indicating some structural or functional differences despite conserving the core catalytic mechanism .
Some substitutions in lnt result in temperature-dependent effects, where the enzyme functions at lower temperatures but not at higher temperatures . These temperature-sensitive mutations are located at different positions in the structural model and do not appear to affect protein stability directly . This suggests they may influence conformational dynamics or substrate interactions in a temperature-dependent manner.
The identification of these conserved residues provides valuable insights into the enzyme's mechanism and offers potential targets for the development of specific inhibitors.
The expression and purification of recombinant Pseudomonas aeruginosa Apolipoprotein N-acyltransferase (lnt) requires specialized techniques due to its membrane-bound nature. The following methodological approach has been successful for researchers:
For bacterial expression, E. coli strains specifically designed for membrane protein expression (such as C41/C43) yield better results than standard strains . Vector selection should consider fusion tags that enhance solubility and facilitate purification. The pCold TF expression vector system has been successfully used for similar membrane proteins, providing a cold shock promoter that reduces inclusion body formation .
Expression should be conducted at lower temperatures (16-20°C) after induction to promote proper folding and membrane insertion . Using reduced concentrations of inducer (0.1-0.5 mM IPTG) can help prevent aggregation and toxicity associated with membrane protein overexpression . The expression can be monitored by SDS-PAGE analysis of cell lysates, with expected size for P. aeruginosa lnt being approximately 57 kDa .
After cell disruption by sonication or high-pressure homogenization, the membrane fraction containing lnt should be isolated by ultracentrifugation . Proper solubilization of the membrane-bound enzyme requires careful selection of detergents. Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LDAO (lauryldimethylamine oxide) at concentrations above their critical micelle concentration are typically effective .
A multi-step purification approach is recommended:
Affinity chromatography using the fusion tag (His-tag is commonly used)
Size exclusion chromatography to remove aggregates and ensure homogeneity
Optional ion-exchange chromatography for further purification if needed
Throughout purification, it is essential to maintain detergent concentrations above the critical micelle concentration to prevent protein aggregation .
The purified recombinant protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for medium-term storage or at -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .
This optimized approach has been successfully applied to produce functional recombinant Pseudomonas aeruginosa Apolipoprotein N-acyltransferase for both structural and functional studies.
Assessing the activity of recombinant Apolipoprotein N-acyltransferase (lnt) requires specialized methods that can detect and quantify the N-acylation of lipoprotein substrates. The following methodological approaches provide researchers with multiple options for activity assessment:
This traditional approach uses radiolabeled phospholipids (typically 14C or 3H-labeled) as acyl donors. After incubation with purified lnt and lipoprotein substrate, the reaction products are separated by thin-layer chromatography or SDS-PAGE, and incorporation of radioactivity into lipoproteins is quantified by autoradiography or scintillation counting . This method offers high sensitivity but requires special handling of radioactive materials.
Mass spectrometry provides a direct and sensitive method to detect the mass shift associated with N-acylation of lipoprotein substrates . This approach can differentiate between diacylated and triacylated forms of the lipoprotein and can even identify the specific acyl chain transferred. Both MALDI-TOF and LC-MS/MS have been successfully employed for this purpose.
Using fluorescently labeled lipoprotein substrates or coupled enzyme assays that produce fluorescent products can provide continuous real-time monitoring of lnt activity . These assays are amenable to high-throughput screening but may require careful optimization to minimize interference from detergents used to solubilize the enzyme.
Since lnt is essential in most gram-negative bacteria, functional complementation assays provide a powerful tool to assess activity . This involves expressing the recombinant lnt in a conditional lnt mutant strain and evaluating growth restoration under non-permissive conditions . Variations in this approach can use temperature-sensitive mutants to assess partial activity.
The migration of lipoproteins on SDS-PAGE can differ based on their acylation state. This property can be exploited to monitor lnt activity by observing shifts in mobility of substrate lipoproteins after treatment with the enzyme .
Using antibodies that specifically recognize properly processed lipoproteins can provide a straightforward method to assess lnt activity in both in vitro and in vivo settings .
X-ray crystallography and cryo-electron microscopy have been used to visualize the structural changes that occur during the reaction cycle, including the formation of the acyl-enzyme intermediate . While not suitable for routine activity assessment, these approaches provide valuable insights into the catalytic mechanism.
By employing a combination of these methods, researchers can comprehensively characterize the activity of recombinant Apolipoprotein N-acyltransferase and evaluate the effects of mutations or potential inhibitors on its function.
Site-directed mutagenesis has been instrumental in elucidating the structure-function relationships of Apolipoprotein N-acyltransferase (lnt). By systematically altering specific amino acids and assessing their impact on enzyme function, researchers have identified critical residues and gained insights into the catalytic mechanism:
Mutagenesis studies have confirmed the essential role of the putative catalytic triad (E267, K335, C387 in E. coli numbering) . Substitution of C387, the nucleophilic cysteine that forms the thioester intermediate, results in complete loss of activity . Similarly, mutations of E267 and K335 severely impair enzyme function, confirming their roles in the catalytic mechanism . These findings validate the proposed ping-pong mechanism where the cysteine residue forms a covalent intermediate with the acyl chain from the phospholipid donor.
Residues Y388 and E389, which form part of the hydrophobic pocket constituting the active site, are absolutely required for lnt function . Mutation of these residues directly affects the modification of Braun's lipoprotein Lpp, a model substrate used in many studies . The proximity of these residues to the catalytic cysteine (C387) suggests they play important roles in substrate positioning and stabilization during catalysis.
Residues W237 and E343 are located on two flexible arms that face away from the active site and are expected to participate in substrate binding and release . Mutagenesis of these residues significantly impairs enzyme function, indicating their importance in the catalytic cycle . Their location suggests they may be involved in conformational changes that occur during the binding and release of phospholipid and/or apolipoprotein substrates.
Several substitutions result in temperature-dependent effects, where the enzyme functions at lower temperatures (e.g., 30°C) but not at higher temperatures (e.g., 42°C) . These mutations are located at different positions in the structural model and do not appear to affect protein stability directly . This suggests they may influence conformational dynamics or substrate interactions in a temperature-dependent manner.
Mutagenesis studies have also revealed that the essential residues identified in E. coli lnt are conserved in functional homologs from other proteobacteria, including P. aeruginosa . This conservation underscores their fundamental importance in the enzyme's mechanism across bacterial species.
These mutagenesis studies have collectively provided a molecular framework for understanding lnt function and have identified potential targets for the development of specific inhibitors that could serve as novel antibiotics against gram-negative pathogens.
The ping-pong mechanism of Apolipoprotein N-acyltransferase (lnt) is supported by multiple lines of experimental evidence from structural, biochemical, and genetic studies:
X-ray crystallography and cryo-electron microscopy have provided direct visual evidence for the ping-pong mechanism by capturing snapshots of the enzyme at different stages of the reaction . These structural studies have identified a single active site that binds substrates sequentially, with distinct conformational states observed for the enzyme when bound to different substrates . The visualization of the acyl-enzyme intermediate, where the acyl chain is covalently attached to the catalytic cysteine (C387), provides compelling support for the first half of the ping-pong reaction .
Enzymatic assays with purified lnt have demonstrated kinetic patterns consistent with a ping-pong mechanism, including characteristic parallel lines in Lineweaver-Burk plots when varying concentrations of both substrates . Mass spectrometry analyses have detected the acyl-enzyme intermediate, confirming the formation of the covalent thioester bond between the catalytic cysteine and the acyl chain from the phospholipid donor .
Site-directed mutagenesis studies have provided genetic evidence supporting the ping-pong mechanism . Substitution of the catalytic cysteine (C387) completely abolishes enzyme activity, consistent with its proposed role as the nucleophile that forms the acyl-enzyme intermediate . Similarly, mutations of other catalytic triad residues (E267 and K335) severely impair enzyme function, supporting their roles in the proposed mechanism .
Investigations of substrate preferences have revealed that lnt can use various phospholipids as acyl donors and accept different lipoprotein substrates . This promiscuity is explained by the ping-pong mechanism, where the enzyme's active site has evolved to recognize general structural and chemical features rather than specific sequences . The ability to bind substrates that satisfy structural and chemical criteria positions their reactive parts adjacent to the catalytic triad for reaction .
The development of mechanism-based inhibitors that target specific steps in the ping-pong reaction has provided additional evidence for this mechanism . Compounds that form stable analogs of the acyl-enzyme intermediate or that mimic transition states in either half-reaction have shown inhibitory activity against lnt, consistent with the proposed mechanism .
Collectively, these diverse lines of evidence strongly support the ping-pong mechanism for Apolipoprotein N-acyltransferase (lnt) and provide a solid foundation for understanding its catalytic function and potential for inhibitor development.
The bacterial membrane environment plays a crucial role in modulating Apolipoprotein N-acyltransferase (lnt) activity through multiple mechanisms:
As a membrane-bound enzyme, lnt is strategically positioned to access both its lipid and protein substrates . The phospholipid substrates are integral components of the bacterial membrane, and their lateral diffusion within the membrane bilayer facilitates their encounter with the enzyme's active site . Similarly, newly synthesized diacylated lipoproteins are directed to the membrane where lnt catalyzes their final modification step . This co-localization of enzyme and substrates within the membrane microenvironment enhances reaction efficiency.
The lipid composition of the bacterial membrane significantly impacts lnt activity and substrate specificity . Different bacterial species have distinct phospholipid profiles, which influences the predominant acyl chains transferred by lnt to lipoprotein substrates . For instance, P. aeruginosa membranes contain phosphatidylethanolamine (PE), phosphatidylglycerol (PG), and phosphatidylcholine (PC), all of which can potentially serve as acyl donors for lnt with varying efficiencies .
The membrane environment provides structural support for lnt, which contains multiple transmembrane domains . These hydrophobic regions anchor the enzyme in the membrane and help maintain its proper three-dimensional conformation . When extracted from the membrane for in vitro studies, detergents or other membrane mimetics must be carefully selected to preserve the enzyme's structural integrity and activity .
The physical properties of the membrane, including its fluidity and thickness, can influence the conformational dynamics of lnt during the catalytic cycle . The flexible arms of the enzyme, which contain residues W237 and E343, are thought to undergo opening and closing movements upon substrate binding and release . These movements may be modulated by membrane properties, affecting substrate access to the active site.
Lnt functions as part of a larger lipoprotein processing machinery that includes other membrane-associated enzymes such as signal peptidase II (LspA) and lipoprotein diacylglyceryl transferase (Lgt) . The spatial organization of these enzymes within the membrane may facilitate the sequential processing of lipoprotein substrates through a substrate channeling mechanism.
Understanding these complex interactions between lnt and the bacterial membrane environment is essential for accurately interpreting experimental results and designing effective inhibitors. When working with recombinant lnt, researchers must carefully consider the membrane mimetic systems used for in vitro studies to ensure they adequately recapitulate the native membrane environment.
Multiple structural techniques have provided complementary insights into the structure and function of Apolipoprotein N-acyltransferase (lnt), each offering unique advantages for different aspects of study:
X-ray crystallography has been instrumental in determining high-resolution structures of lnt, revealing atomic details of the enzyme's active site and catalytic mechanism . This technique has successfully captured different conformational states of the enzyme during its catalytic cycle, providing "structure snapshots" that chart the structural changes undergone during the reaction progress . These structures have identified a single active site that binds substrates sequentially, validating the proposed ping-pong mechanism .
Cryo-EM has emerged as a powerful complement to crystallography for studying membrane proteins like lnt . This technique has the advantage of visualizing the protein in a more native-like environment without the need for crystallization, which can be particularly challenging for membrane proteins . Recent advances in cryo-EM have enabled researchers to obtain near-atomic resolution structures of lnt in different conformational states, providing insights into the enzyme's dynamics during catalysis .
Computational approaches based on sequence conservation and known protein structures have been used to predict models for lnt, identifying it as a member of the CN hydrolase family . These models have guided experimental design and interpretation, particularly for site-directed mutagenesis studies targeting conserved residues .
While not a structural technique per se, site-directed mutagenesis coupled with functional assays has been essential for validating structural models and identifying functionally important residues . This approach has confirmed the roles of the catalytic triad (E267, K335, C387) and identified additional essential residues like Y388, E389, W237, and E343 .
Mass spectrometry-based approaches have provided valuable structural information about lnt, including the identification of post-translational modifications and protein-substrate interactions . This technique has been particularly useful for detecting the acyl-enzyme intermediate formed during catalysis, providing direct evidence for the ping-pong mechanism .
The most comprehensive insights have come from integrating multiple structural techniques. For example, combining X-ray crystallography and cryo-EM has allowed researchers to chart the structural changes that occur during the reaction cycle with greater confidence than either technique alone . Additionally, integrating structural data with biochemical and genetic studies has provided a more complete understanding of structure-function relationships in lnt.
These structural studies collectively have validated the ping-pong mechanism of lnt, explained the molecular basis for its substrate promiscuity, and provided valuable information for structure-based drug design targeting this essential bacterial enzyme .
The development of inhibitors targeting Apolipoprotein N-acyltransferase (lnt) represents a promising approach for creating novel antibiotics against Pseudomonas aeruginosa and other Gram-negative pathogens. This approach leverages the enzyme's essential role in bacterial lipoprotein processing and the absence of homologous enzymes in humans :
With the availability of detailed structural information from X-ray crystallography and cryo-electron microscopy, structure-based approaches can now target specific features of lnt . The catalytic triad (E267, K335, C387) represents an obvious target, particularly the nucleophilic cysteine that forms the acyl-enzyme intermediate . Compounds designed to react with or block this cysteine could effectively inhibit enzyme function. Additionally, the hydrophobic pocket containing Y388 and E389, which is essential for enzyme activity, provides another promising target site .
Understanding the ping-pong mechanism of lnt enables the design of inhibitors that mimic reaction intermediates or transition states . For example, stable analogs of the acyl-enzyme intermediate could compete with natural substrates and block the catalytic cycle. Similarly, compounds that mimic the tetrahedral transition state during acyl transfer could serve as potent inhibitors.
Inhibitors can be designed to compete with either the phospholipid donor or the lipoprotein acceptor substrates . Modified phospholipids that bind but cannot transfer their acyl chain, or peptide mimetics that occupy the lipoprotein binding site without undergoing acylation, could effectively block enzyme activity. The substrate promiscuity of lnt suggests that a variety of structural scaffolds might be accommodated in the active site .
While the catalytic mechanism of lnt is conserved across bacterial species, there are structural differences that could be exploited for species-selective inhibition . Lnt from P. aeruginosa has unique features compared to homologs from other bacteria, potentially allowing for the development of species-specific inhibitors with reduced broad-spectrum effects.
High-throughput screening of compound libraries against purified recombinant lnt can identify initial hit compounds . These hits can then be optimized through medicinal chemistry approaches, guided by structural information and structure-activity relationship studies. Compounds should be evaluated for inhibitory potency, selectivity over human enzymes, bacterial cell penetration, and resistance to efflux pumps.
Promising inhibitors should be assessed in multiple assay systems:
Biochemical assays with purified enzyme to determine mechanism of inhibition and potency
Cellular assays to confirm on-target activity and antibacterial effects
Resistance development studies to assess the potential for rapid resistance emergence
Animal infection models to evaluate in vivo efficacy and pharmacokinetic properties
This multi-faceted approach to inhibitor development, combining structural insights with mechanistic understanding and medicinal chemistry expertise, offers a path toward novel antibiotics targeting this essential bacterial enzyme. As lnt has no equivalents in humans, inhibitors designed against this enzyme have the potential for high selectivity and minimal off-target effects .
Working with recombinant membrane proteins such as Apolipoprotein N-acyltransferase (lnt) presents numerous technical challenges throughout the research process. Understanding and addressing these challenges is crucial for successful experimental outcomes:
Membrane proteins like lnt are notoriously difficult to express in recombinant systems due to their hydrophobic nature and potential toxicity to host cells . When overexpressed, they often aggregate into inclusion bodies or cause membrane stress leading to reduced cell viability . To overcome these challenges, researchers must carefully optimize expression conditions, including temperature, inducer concentration, and host strain selection . The use of specialized expression systems like pCold TF vector, which includes a solubility-enhancing fusion partner and allows for cold-shock induction, has proven beneficial for similar membrane proteins .
Extracting lnt from the membrane while maintaining its native conformation and activity requires careful selection of detergents or other membrane mimetics . Different detergents vary in their ability to solubilize the protein without causing denaturation. Once extracted, membrane proteins often show reduced stability compared to soluble proteins, necessitating careful buffer optimization and handling procedures . The recommended storage in Tris-based buffer with 50% glycerol at -20°C helps maintain stability, but repeated freeze-thaw cycles should be avoided .
Purification of membrane proteins typically yields lower amounts compared to soluble proteins, requiring larger culture volumes and optimized purification protocols . The presence of detergent micelles complicates many standard purification techniques and can interfere with protein quantification and activity assays . Throughout the purification process, detergent concentration must be maintained above the critical micelle concentration to prevent protein aggregation .
Obtaining high-resolution structural information for membrane proteins like lnt presents additional challenges . Crystallization of membrane proteins in detergent micelles is often more difficult than for soluble proteins, requiring extensive screening of conditions . Cryo-electron microscopy offers an alternative approach but has its own technical demands, particularly for proteins of intermediate size like lnt . Despite these challenges, researchers have successfully used both X-ray crystallography and cryo-EM to chart the structural changes of lnt during its reaction cycle .
Developing reliable assays to measure lnt activity can be complicated by the need to present both membrane-derived (phospholipid) and protein substrates in appropriate conformations . The hydrophobic nature of these substrates and the requirement for a suitable membrane-like environment add complexity to assay design and interpretation . In vivo complementation assays offer a powerful alternative but may not provide mechanistic details about enzyme function .
For comprehensive functional studies, reconstitution of purified lnt into membrane-mimetic systems (liposomes, nanodiscs, or bicelles) that better represent the native environment may be necessary . This reconstitution process adds additional technical steps and variables that must be optimized for each specific application.
By understanding and systematically addressing these challenges, researchers can successfully work with recombinant Apolipoprotein N-acyltransferase and other membrane proteins to gain valuable insights into their structure, function, and potential as therapeutic targets.