Recombinant Pseudomonas aeruginosa ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Pseudomonas aeruginosa ATP synthase subunit b (atpF) is a bacterial peripheral stalk protein critical for ATP synthesis and proton translocation in the F₁F₀-ATP synthase complex. The full-length protein (1–156 amino acids) is recombinantly expressed, typically in E. coli, with an N-terminal His-tag for purification . Its role as a stator in the enzyme’s rotary mechanism positions it as a key target for studying bacterial energy metabolism and pathogenesis .

Production and Purification

Recombinant atpF is produced in E. coli using standard protocols, with optimized yields under simulated microgravity (SMG) conditions, which enhance plasmid copy numbers and protein folding .

ParameterSpecificationSource
Host OrganismE. coli (common), yeast, or baculovirus
Expression VectorpET or other T7 promoter-based systems
Purification TagN-terminal His-tag
Purity>90% (via Ni-NTA affinity chromatography)

Suppliers:

  • Creative Biolabs: Offers atpF from E. coli or alternative hosts for vaccine research .

  • Cusabio: Provides recombinant atpF for antibody development and structural studies .

Functional Role in ATP Synthase

Subunit b acts as a stator in the F₁F₀-ATP synthase complex, counteracting rotational forces from the central stalk (γ subunit) and c-ring. Its dimerization domain forms a rigid structure that transmits energy between F₁ and F₀ sectors .

Key Interactions:

  • δ subunit: Binds to the C-terminal δ-binding domain, stabilizing F₁ .

  • a subunit: Interacts via the membrane-spanning region in the F₀ sector .

Applications in Research and Biotechnology

  1. Vaccine Development: Recombinant atpF is explored as a candidate antigen for targeting P. aeruginosa infections .

  2. Structural Studies: Used to model bacterial ATP synthase dynamics and drug-target interactions .

  3. Biofilm Research: While not directly studied in P. aeruginosa, ATP synthase in Staphylococcus aureus influences biofilm persistence and immune evasion .

Challenges and Future Directions

  • Limited Direct Studies: Most structural and functional data derive from E. coli homologs; P. aeruginosa-specific studies are needed.

  • Therapeutic Targeting: Inhibitors disrupting subunit b’s dimerization or δ-binding domains could combat antibiotic-resistant P. aeruginosa strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; PA5558; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
atpF
Target Protein Sequence
MNINATLIGQSVAFFIFVLFCMKFVWPPVIAALQERQKKIADGLDAANRAARDLELAHEK AGQQLREAKAQAAEIVEQAKKRANQIVDEARDQARTEGERLKAQAQAEIEQELNSVKDAL RAQVGALAVTGAEKILGASIDANAHEQLVSKLAAEI
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links

KEGG: pae:PA5558

STRING: 208964.PA5558

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) and what is its functional significance in P. aeruginosa?

ATP synthase subunit b (atpF) is an essential component of the ATP synthase complex in P. aeruginosa, forming part of the membrane-embedded F0 portion. This multisubunit enzyme is critical for energy production, homeostasis, and maintenance of the proton motive force in bacterial cells . The ATP synthase complex is driven by the proton motive force generated by the respiratory chain and functions primarily to synthesize ATP .

ATP synthase plays a particularly important role in P. aeruginosa's ability to adapt to various environments and stressors. Research shows that disruption of ATP synthase components, including atpF, can significantly affect bacterial fitness, virulence, and response to antibiotics .

How does ATP synthase participate in P. aeruginosa's adaptation to different environmental conditions?

P. aeruginosa utilizes ATP synthase as a central component in its adaptation strategies. During experimental evolution studies, changes in ATP synthase function have been observed when P. aeruginosa is subjected to continuous exponential phase cultivation . These adaptations can lead to increased fitness under specific growth conditions.

The ATP synthase complex also responds to various stressors. For example, when exposed to antimicrobial compounds such as 3-hydroxyphenylacetic acid (3-HPAA), P. aeruginosa shows significant proteomic changes related to energy metabolism, including alterations in ATP synthase components . This adaptation mechanism allows the bacterium to modulate energy production in response to environmental challenges.

What expression systems are most effective for producing recombinant P. aeruginosa atpF?

Based on research with similar ATP synthase subunits, E. coli expression systems have proven effective for recombinant production of ATP synthase components. For optimal expression, several fusion protein approaches have been documented:

Expression VectorFusion TagPromoterHost StrainNotes
pMAL-c2xMBPtacE. coli BL21 derivativesEnhances solubility and expression levels
pET-32a(+)NoneT7E. coli BL21Strong inducible expression
pFLAGFLAGtacE. coliFacilitates detection and purification

Research indicates that fusion to maltose-binding protein (MBP) significantly improves the expression and solubility of recombinant ATP synthase subunits, as demonstrated in studies with similar membrane proteins . The pMAL-c2x-malE/atpH construct has shown success in expressing other ATP synthase subunits and may be adaptable for atpF expression .

What purification strategies yield high-quality recombinant P. aeruginosa atpF protein?

Effective purification of atpF requires specialized techniques due to its hydrophobic nature as a membrane protein. Based on studies with similar ATP synthase subunits, a multi-step purification approach is recommended:

  • Affinity chromatography: When expressed as a fusion protein with MBP, amylose resin chromatography provides effective initial purification .

  • Cleavage of fusion tags: Factor Xa protease can be used to separate the atpF protein from fusion partners .

  • Secondary purification: Additional chromatography steps may include ion exchange or size exclusion to achieve high purity.

For membrane proteins like atpF, incorporating detergents in the purification buffers is crucial to maintain protein solubility and stability throughout the purification process.

How can aqueous two-phase flotation (ATPF) techniques be applied to purify recombinant atpF?

ATPF represents an innovative approach for purifying recombinant proteins like atpF that may be challenging to isolate by conventional methods. This technique combines aqueous two-phase systems with solvent sublation:

  • The system utilizes ethylene oxide and propylene oxide (EOPO) copolymers with ammonium sulfate to create a two-phase system.

  • Nitrogen gas is passed through the protein solution, adsorbing surface-active compounds.

  • The target protein accumulates in the top phase, which can be further separated at a lower critical solution temperature.

This technique has shown up to 75% recovery of EOPO and successful purification of bacterial proteins in a single downstream processing step . For atpF, ATPF could potentially offer advantages in terms of reduced organic solvent consumption and improved environmental sustainability compared to traditional methods.

How is ATP synthase activity measured in P. aeruginosa?

ATP synthase activity in P. aeruginosa can be measured using a luminescence-based assay with inverted membrane vesicles:

  • Preparation of inverted membrane vesicles from P. aeruginosa cultures

  • Energizing the endogenous electron transport system with β-d-nicotinamide adenine dinucleotide (NADH) to generate a proton gradient

  • Adding ADP and phosphate to allow ATP synthesis

  • Detecting synthesized ATP using a luciferin-luciferase assay system

This method requires careful controls to account for residual ATP in membrane vesicles and non-ATP synthase sources of ATP synthesis, typically by including parallel reactions with protonophores . When testing potential inhibitors, samples should be diluted 500-fold before the ATP detection reaction to minimize interference with luciferase .

What methods are used to study the role of atpF in bacterial pathogenesis?

Several experimental approaches can be employed to investigate atpF's role in P. aeruginosa pathogenesis:

  • Gene replacement mutations: Creating deletion mutants of atpF using techniques such as homologous recombination or CRISPR-Cas9 systems .

  • Transcriptomic analysis: RNA-seq to analyze global transcriptional changes in response to atpF mutation or inhibition .

  • Proteomic studies: Mass spectrometry-based proteomics to identify protein-protein interactions and changes in protein expression profiles .

  • In vivo infection models: Animal models such as zebrafish larvae can be used to study the impact of atpF mutations on infection dynamics and host immune responses .

Specific techniques from the literature include bacterial two-hybrid assays to identify protein-protein interactions and far western dot blotting using purified proteins to validate these interactions .

How can atpF be used as a reference gene in molecular studies?

The atpF gene serves as a valuable internal reference gene in quantitative PCR experiments due to its stable expression under various conditions. Research has demonstrated its utility as a chromosomal single-copy reference for determining plasmid copy numbers:

  • Primers targeting the atpF gene region and the plasmid sequence of interest are designed.

  • Bacterial genomic DNA is extracted using commercial kits.

  • qPCR is performed using a suitable reagent kit (e.g., TB Green Premix Ex Taq II).

  • The plasmid copy number (PCN) is calculated using the relative quantification formula 2^(-ΔΔCT) with atpF as the reference gene .

This approach allows researchers to accurately quantify changes in plasmid copy numbers in response to various conditions, such as antimicrobial pressure .

How does ATP synthase contribute to P. aeruginosa biofilm formation and persistence?

ATP synthase plays a critical role in P. aeruginosa biofilm formation and persistence through multiple mechanisms:

  • Energy production for biofilm matrix synthesis and maintenance

  • Contribution to adaptation during biofilm development

  • Influence on host immune responses during biofilm-associated infections

Research with S. aureus demonstrates that ATP synthase is essential for biofilm persistence in prosthetic joint infection models, with ATP synthase mutants showing impaired biofilm formation and increased sensitivity to immune clearance . Similar mechanisms likely exist in P. aeruginosa, where ATP synthase activity affects cellular metabolism and stress responses crucial for biofilm development.

Experimental evidence indicates that disruption of ATP synthase can lead to a diffuse biofilm structure that allows greater immune cell infiltration and enhanced clearance by the host immune system . This suggests that targeting ATP synthase could be a strategy to enhance biofilm clearance during P. aeruginosa infections.

What proteomic changes occur in ATP synthase components during antimicrobial exposure?

Proteomic studies reveal significant changes in ATP synthase components when P. aeruginosa is exposed to antimicrobial compounds. For example, when treated with 3-hydroxyphenylacetic acid (3-HPAA), P. aeruginosa shows alterations in multiple ATP synthase subunits as part of its response to this antimicrobial stress .

These proteomic changes are part of a broader bacterial response involving multiple cellular processes:

Cellular ProcessEffect of Antimicrobial TreatmentATP Synthase Involvement
DNA replication/repairAltered protein expressionATP provision for repair mechanisms
RNA degradationChanges in RNA processing enzymesEnergy-dependent processes
Membrane transportModification of transport systemsMembrane potential maintenance
Oxidative phosphorylationAltered electron transport chain componentsDirect involvement of ATP synthase
Energy metabolismChanges in metabolic enzyme levelsATP production modulation

The study of these proteomic changes provides insights into how P. aeruginosa adapts to antimicrobial stress and can inform the development of new therapeutic approaches targeting ATP synthase .

How does P. aeruginosa ATP synthase respond to c-di-GMP signaling?

Cyclic di-GMP (c-di-GMP) is a second messenger that plays a central role in regulating transitions between planktonic and biofilm lifestyles in P. aeruginosa. While direct evidence for c-di-GMP regulation of ATP synthase is limited, research indicates potential connections:

  • The global regulator FleQ responds to c-di-GMP levels and regulates various cellular processes in P. aeruginosa .

  • C-di-GMP signaling influences lipopolysaccharide modification and membrane protein expression, which could indirectly affect ATP synthase function .

  • Changes in the bacterial envelope in response to c-di-GMP may alter the environment in which ATP synthase operates .

Understanding these regulatory connections requires further research but represents an important area for investigating the integration of energy metabolism with biofilm formation and virulence in P. aeruginosa.

Why is ATP synthase considered a promising antibiotic target for P. aeruginosa?

ATP synthase represents an attractive antibiotic target against P. aeruginosa for several key reasons:

  • Essential function: ATP synthase is critical for bacterial energy production and survival .

  • Structural differences: Bacterial ATP synthase differs structurally from human ATP synthase, allowing for selective targeting .

  • Proven success: The success of bedaquiline as an anti-tuberculosis drug targeting mycobacterial ATP synthase demonstrates this approach's viability .

  • Low resistance potential: Targeting this essential enzyme may reduce the development of resistance compared to conventional antibiotics .

  • New mechanism of action: ATP synthase inhibitors represent a novel class of antibiotics with mechanisms distinct from existing drugs .

P. aeruginosa in particular is challenging to treat due to its intrinsic and acquired resistance mechanisms, making new targets like ATP synthase especially valuable for developing effective treatments .

What approaches are used to develop inhibitors targeting P. aeruginosa ATP synthase?

Development of P. aeruginosa ATP synthase inhibitors involves several complementary approaches:

  • Structure-based design: Using structural information about ATP synthase to design compounds that bind to critical sites.

  • Quinoline analog development: Synthesis and evaluation of C1/C2 quinoline analogs for their ability to inhibit P. aeruginosa ATP synthase .

  • In vitro screening: Assessment of compounds using luminescence-based assays with inverted membrane vesicles .

  • Structure-activity relationship studies: Identification of key molecular features that enhance inhibitory activity.

Research has identified that bulky/hydrophobic C1/C2 substitutions on quinoline scaffolds are preferred for inhibiting P. aeruginosa ATP synthase, with several compounds showing dose-dependent inhibition with IC50 values in the 2-17 μg/mL range .

The evaluation process typically includes:

  • Assessment of ATP synthesis inhibition

  • Control experiments to rule out interference with the proton gradient

  • Verification of selectivity for bacterial versus human ATP synthase

  • Testing of antimicrobial activity against wild-type P. aeruginosa

How do mutations in ATP synthase affect antibiotic susceptibility and bacterial fitness?

Mutations in ATP synthase components can significantly alter both antibiotic susceptibility and bacterial fitness in P. aeruginosa:

  • Increased antibiotic sensitivity: Studies show that inactivation of ATP synthase leads to increased susceptibility to polymyxins, gentamicin, and nitric oxide .

  • Growth impairment: ATP synthase mutations affect bacterial growth in both planktonic and biofilm conditions .

  • Altered virulence: Disruption of ATP synthase can reduce toxin and protease production, affecting the bacterium's ability to cause infection .

  • Enhanced immune clearance: ATP synthase mutants may elicit heightened proinflammatory responses from host immune cells, leading to improved bacterial clearance .

  • Metabolic adaptations: Bacteria may develop compensatory mechanisms to maintain energy production when ATP synthase is compromised .

These findings suggest that ATP synthase mutations represent a double-edged sword - while they may reduce bacterial fitness, they can also drive evolutionary adaptations that potentially alter the course of infection and treatment response .

How can proteomics approaches advance our understanding of ATP synthase function in P. aeruginosa?

Proteomics approaches offer powerful tools for understanding ATP synthase function in P. aeruginosa:

  • Protein-protein interaction networks: Techniques such as pull-down assays, bacterial two-hybrid screens, and immunoprecipitation can identify proteins that interact with ATP synthase subunits .

  • Differential protein expression analysis: Mass spectrometry-based proteomics can reveal how ATP synthase components change in response to environmental conditions, antimicrobial agents, or genetic modifications .

  • Post-translational modification mapping: Identifying modifications of ATP synthase subunits that affect function or regulation.

  • Subcellular localization studies: Determining the precise localization of ATP synthase subunits within the bacterial cell .

For example, mass spectrometry has revealed that ATP synthase subunits β (ATP5B), α (ATP5A), and O (ATP5O) can interact with flagellar hook protein FlgE, suggesting unexpected connections between ATP synthase and bacterial motility structures . Similar approaches could uncover novel interactions and functions of atpF in P. aeruginosa.

What role does ATP synthase play in the evolution of antimicrobial resistance in P. aeruginosa?

ATP synthase contributes to antimicrobial resistance evolution in P. aeruginosa through several mechanisms:

  • Energy provision for resistance mechanisms: ATP-dependent efflux pumps require energy from ATP synthase to expel antibiotics .

  • Adaptation to antimicrobial pressure: P. aeruginosa can evolve altered ATP synthase expression or function during continuous exposure to antibiotics .

  • Biofilm persistence: ATP synthase supports biofilm formation, which provides inherent resistance to many antimicrobials .

  • Stress response coordination: ATP synthase activity is linked to cellular responses to various stressors, including antibiotics .

Experimental evolution studies have shown that P. aeruginosa undergoes significant changes in metabolism and energy production pathways when subjected to antimicrobial pressure . Understanding how ATP synthase participates in these adaptations could provide insights into novel approaches to combat resistance development.

How can CRISPR-Cas9 genome editing advance functional studies of atpF in P. aeruginosa?

CRISPR-Cas9 genome editing offers transformative approaches for studying atpF function:

  • Precise gene deletion: Creating clean atpF deletion mutants without polar effects on other genes in the ATP synthase operon .

  • Point mutations: Introducing specific mutations to study structure-function relationships.

  • Promoter modifications: Altering atpF expression levels to understand dosage effects.

  • Fluorescent protein fusions: Creating reporter constructs to visualize atpF localization and expression patterns.

  • Inducible systems: Developing conditional atpF expression systems to study essentiality.

CRISPR-Cas9 targeting can be used not only for chromosomal modifications but also for eliminating plasmids from bacterial populations, as demonstrated with the pCasCure-Apr plasmid targeting IncX3 plasmids . Similar approaches could be developed to specifically study the role of atpF in various cellular processes.

The technique's precision allows researchers to answer questions about specific domains or residues within atpF that are critical for ATP synthase assembly, function, or interactions with other cellular components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.