Recombinant Pseudomonas aeruginosa Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa Cardiolipin Synthase (Cls)

Recombinant Pseudomonas aeruginosa Cardiolipin Synthase (Cls) is an enzyme that facilitates the synthesis of cardiolipin (CL) in the bacterium Pseudomonas aeruginosa . Cardiolipin is a unique phospholipid found in bacterial membranes and mitochondrial membranes of eukaryotes, playing a crucial role in stabilizing membrane . Cls catalyzes the formation of cardiolipin (CL) from two phosphatidylglycerol (PG) molecules .

Function and Significance of Cardiolipin Synthase

Cardiolipin synthase (Cls) is essential for the synthesis of cardiolipin, a phospholipid vital for various cellular processes in bacteria .

Key Functions of Cardiolipin:

  • Membrane Stability: Cardiolipin stabilizes bacterial membranes, ensuring proper spatial segregation, recruitment, and activity of membrane proteins .

  • Protein Stability: It induces an increase in protein stability, as demonstrated in studies with E. coli where it affects the tetrameric water efflux channel (AqpZ) and the Na+/H+ antiporter (NhaA) .

  • Membrane Dynamics: Due to its cone-like shape, cardiolipin stabilizes negative membrane curvature and promotes transitions from lamellar to non-lamellar phases, which is critical for bacterial division involving membrane fission and fusion .

Pseudomonas aeruginosa and Cardiolipin Synthase

Pseudomonas aeruginosa is a bacterium known for affecting patients with lung diseases, such as cystic fibrosis, and those with compromised immune systems . Sphingosine induces a degradation of cardiolipin via the maintenance of lipid asymmetry (Mla) system in P. aeruginosa .

Role in Antibiotic Resistance:

  • Mutations in Cls have been associated with resistance to daptomycin (DAP) in bacteria .

  • Studies have shown that increased cardiolipin content can affect the antimicrobial activity of certain antibiotics, suggesting a role in bacterial defense mechanisms .

Research Findings

4.1. Sphingosine-Mediated Cardiolipin Degradation
Research indicates that sphingosine, a lipid present in the respiratory tract, can induce the degradation of cardiolipin in P. aeruginosa, leading to bacterial death .

  • Mechanism: Sphingosine causes changes in the bacterial membrane, leading to the degradation of cardiolipin via the Mla system .

  • Enzyme Inhibition: Inhibitors of phospholipase A2 (PLA2) can reduce or abolish the effects of sphingosine on cardiolipin degradation, suggesting a PLA2-like activity is involved .

  • Experimental Evidence: Studies using [*14C]acetate to label bacterial lipids confirmed that sphingosine induces a rapid degradation of cardiolipin .

4.2. Cardiolipin's Effect on Antimicrobial Activity
The presence of cardiolipin influences the effectiveness of antimicrobial agents against P. aeruginosa .

  • Growth Delay: Addition of cardiolipin to the culture medium delayed the growth of P. aeruginosa .

  • Enhanced Antibiotic Activity: Increased cardiolipin content enhances the efficiency of certain antibiotics, such as 3’,6-dinonylneamine, against P. aeruginosa .

4.3. Regulation of Two-Component Systems by Cardiolipin
Cardiolipin plays a role in modulating bacterial two-component systems, which are crucial for adapting to environmental changes .

  • SaeS Kinase Activity: Cardiolipin is required for the kinase activity of SaeS, a sensor kinase involved in bacterial adaptation and virulence .

  • Virulence Reduction: Mutants lacking Cls1 and Cls2 exhibit reduced cytotoxicity and lower virulence, indicating that cardiolipin contributes to bacterial pathogenicity .

Biochemical Characterization of Cardiolipin Synthase

5.1. Methods for Studying Cls
Characterization of bacterial cardiolipin synthases has been challenging due to difficulties in producing sufficient amounts of active and purified protein .

  • Expression and Purification: Recent studies have reported expression and purification schemes for functional cardiolipin synthases from bacteria like E. faecalis and E. faecium .

  • Catalytic Activity: Comparing the catalytic activities of different Cls variants helps understand the impact of mutations on enzyme function .

Recombinant Production and Availability

Recombinant Pseudomonas aeruginosa Cardiolipin synthase is available for research purposes .

  • Source: Typically produced in Escherichia coli.

  • Size: Available in various sizes.

  • Storage: Stored in a Tris-based buffer with glycerol at -20℃, with precautions against repeated freezing and thawing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; PA5394; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-490
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
clsA
Target Protein Sequence
MAATGVDKDRPRAMTSTTYLGLLLVGIQVLGFVAAIHAVLTVRTAQGAIAWATSLVFMPY LTLLPYLVFGRSRFDAYIEARRQANREMHLAAAELDWRPWVEEALAARQVSGYKGLKALV RMTRTPTLANNRVRLLVNGEASFEAMFKAISAARQVILVQFFIVRDDALGQRLQQLLLER AANGVEVFFLYDAIGSHALPHRYVERLRQGGVQMHGFSTGSGMLNRFQVNFRNHRKVVVV DGECGFVGGHNVGVEYLGEKPPLAPWRDTHMELRGPAVACLQESFAEDWYWATHSLPPLI LPPQYDSEGALCQVVASGPADAQETCSLFFVEMINAAHERVWITSPYFVPDEAVMAALRL AVLRGVDVRLLIPSRPDHRTVYAASSLYALEAIRAGVKVFRYQPGFLHQKVVLVDRDTAA VGSANLDNRSFRLNFEVMVVTVDEGFAGEVEAMLEADFAESLEFTPEDRRSVRRLQQLGM RVARLVSPIL
Uniprot No.

Target Background

Function

This recombinant Pseudomonas aeruginosa cardiolipin synthase (Cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links

KEGG: pae:PA5394

STRING: 208964.PA5394

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of cardiolipin synthase in Pseudomonas aeruginosa?

Cardiolipin synthase (Cls) in Pseudomonas aeruginosa catalyzes the final step in cardiolipin biosynthesis, specifically the transfer of a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG) to form cardiolipin. This enzyme plays a critical role in bacterial membrane phospholipid composition, particularly in maintaining the asymmetry of the outer membrane .

The enzyme's activity is essential for proper membrane function, as cardiolipin is a key phospholipid found predominantly in bacterial membranes. In P. aeruginosa, cardiolipin synthesis contributes to membrane integrity, which affects various cellular processes including respiration, protein transport, and cell division. The proper functioning of Cls ensures appropriate cardiolipin levels, which is critical for bacterial survival under various environmental conditions and stresses .

How does P. aeruginosa Cls differ from cardiolipin synthases in other bacterial species?

P. aeruginosa Cls shares fundamental catalytic mechanisms with cardiolipin synthases from other bacterial species, but exhibits distinct characteristics in terms of substrate specificity, regulatory mechanisms, and physiological roles:

  • Substrate binding properties: Unlike some other bacterial Cls enzymes, P. aeruginosa membrane phospholipid transport systems, such as those involving Ttg2D, show remarkable promiscuity in binding various molecular species of phospholipids, including cardiolipin .

  • Regulatory mechanisms: The regulation of Cls activity in P. aeruginosa appears to be connected to the maintenance of lipid asymmetry (Mla) system, which differs from regulatory mechanisms observed in organisms like Enterococcus species where Cls mutations are associated with daptomycin resistance .

  • Structural features: While detailed structural information specific to P. aeruginosa Cls is limited, analysis of related proteins suggests that P. aeruginosa Cls may have unique structural elements that influence its substrate specificity and catalytic efficiency compared to Cls enzymes from other bacterial species .

Understanding these differences is crucial for developing targeted approaches to study or modulate cardiolipin synthesis in P. aeruginosa specifically.

How is cardiolipin involved in P. aeruginosa membrane biology?

Cardiolipin plays several critical roles in P. aeruginosa membrane biology:

  • Membrane structure and integrity: Cardiolipin, with its unique dimeric structure containing four acyl chains, contributes to membrane curvature and stability, particularly in regions of high membrane curvature .

  • Outer membrane asymmetry: In P. aeruginosa, cardiolipin is involved in maintaining outer membrane asymmetry through interaction with specific transport systems. The periplasmic phospholipid-binding protein Ttg2D can accommodate up to four acyl chains and bind various molecular species including cardiolipin, suggesting a role in phospholipid trafficking and membrane organization .

  • Response to environmental stress: Cardiolipin synthesis and levels are modulated in response to various environmental stresses, helping P. aeruginosa adapt to changing conditions.

  • Antimicrobial resistance: Recent research indicates that cardiolipin plays a role in bacterial responses to antimicrobial compounds. For instance, sphingosine induces the death of P. aeruginosa by promoting persistent degradation of cardiolipin via the Mla system, leading to severe membrane changes .

These functions highlight why cardiolipin synthesis via Cls is essential for P. aeruginosa viability and pathogenicity.

What are the optimal expression systems for producing recombinant P. aeruginosa Cls?

The optimal expression systems for producing recombinant P. aeruginosa Cls require careful consideration of several factors:

  • Expression vector selection: Vectors containing strong inducible promoters (like T7 or tac) are typically preferred for bacterial membrane proteins like Cls. These should include appropriate tags (His6, GST, or MBP) to facilitate purification while minimizing interference with enzyme activity.

  • Host strain selection: While E. coli is commonly used, specialized strains designed for membrane protein expression (such as C41(DE3), C43(DE3), or Rosetta strains) may provide better yields for P. aeruginosa Cls. For more native-like post-translational modifications, homologous expression in P. aeruginosa itself might be considered, though this approach is technically more challenging.

  • Expression conditions: Optimization of induction parameters is critical - lower temperatures (16-25°C), reduced inducer concentrations, and extended expression times often improve the yield of functional membrane proteins like Cls.

  • Membrane integration: As Cls is an integral membrane protein, expression protocols must ensure proper membrane integration. This may involve co-expression with chaperones or using strains with modified membrane compositions.

For functional studies, researchers have successfully used mammalian expression systems like COS-7 cells for eukaryotic cardiolipin synthases . Similar methodological approaches could be adapted for bacterial Cls, though with appropriate modifications to account for differences in membrane architecture and protein processing.

What purification strategies yield the highest activity of recombinant P. aeruginosa Cls?

Purifying recombinant P. aeruginosa Cls while maintaining its enzymatic activity requires specialized approaches:

  • Membrane preparation: Careful isolation of membrane fractions containing the recombinant Cls should be the first step, typically achieved through differential centrifugation following cell lysis with methods that preserve protein structure (sonication or French press).

  • Solubilization optimization: Critical for membrane proteins like Cls, this step requires screening multiple detergents (DDM, LDAO, or Triton X-100) at various concentrations to efficiently extract Cls from membranes while preserving its native conformation and activity. Detergent concentration, temperature, and duration must be empirically determined.

  • Affinity chromatography: Using engineered affinity tags (typically His6), followed by size exclusion chromatography to remove aggregates and achieve high purity.

  • Stabilization strategies: Throughout purification, inclusion of phospholipids (particularly cardiolipin or its substrate PG) and/or glycerol in buffers can significantly enhance enzyme stability and activity.

  • Activity preservation: Minimal exposure to freezing/thawing cycles and storage in buffers containing stabilizing agents like glycerol (10-20%), reducing agents, and appropriate detergent concentrations at concentrations above the critical micelle concentration.

Previous successful approaches for purifying cardiolipin synthases from bacterial sources have faced challenges with obtaining sufficient amounts of active and highly purified protein . The purification scheme should be validated through activity assays at each step to ensure that the final preparation retains catalytic function.

How can researchers assess the quality and purity of recombinant P. aeruginosa Cls preparations?

Comprehensive quality assessment of recombinant P. aeruginosa Cls preparations involves multiple analytical techniques:

  • Purity analysis:

    • SDS-PAGE with both Coomassie staining and Western blotting using antibodies against the target protein or affinity tag

    • Size-exclusion chromatography to evaluate monodispersity and detect aggregation

    • Mass spectrometry for accurate molecular weight determination and detection of potential contaminants or degradation products

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure composition

    • Fluorescence spectroscopy to assess tertiary structure

    • Thermal shift assays to determine protein stability under various buffer conditions

  • Functional validation:

    • Enzyme activity assays measuring the conversion of CDP-DAG and PG to cardiolipin

    • Native and denaturing mass spectrometry to confirm substrate binding capacity

    • Reconstitution into liposomes to verify membrane insertion and function in a lipid bilayer environment

  • Homogeneity analysis:

    • Dynamic light scattering to assess size distribution and potential aggregation

    • Blue native PAGE to evaluate oligomeric state and complex formation

The gold standard for quality assessment combines structural characterization with functional validation, ensuring that the purified Cls not only appears homogeneous but also retains its native catalytic activity. Researchers should expect a single dominant band corresponding to the expected molecular weight on SDS-PAGE, with enzymatic activity comparable to or higher than that observed in native membrane preparations .

What are the most reliable methods for assessing the enzymatic activity of recombinant P. aeruginosa Cls?

For reliable assessment of recombinant P. aeruginosa Cls enzymatic activity, researchers should consider these methodologically robust approaches:

  • Radiometric assays: Using radiolabeled substrates to directly measure cardiolipin formation:

    • Incorporation of [14C]oleoyl-CoA into cardiolipin via CDP-DAG and PG as substrates

    • Analysis by thin-layer chromatography (TLC) with phosphoimaging for visualization and quantification

    • This approach provides high sensitivity and specificity

  • Mass spectrometry-based assays:

    • LC-MS/MS analysis to detect and quantify both substrate depletion and product formation

    • Native mass spectrometry to confirm substrate binding and product formation

    • Allows detailed analysis of molecular species of cardiolipin produced

  • Fluorescence-based assays:

    • Using fluorescently labeled substrates or coupled enzyme assays

    • Enables continuous monitoring of reaction progress and kinetic measurements

    • More suitable for high-throughput applications

  • Coupled enzyme assays:

    • Monitoring byproduct formation (such as CMP release) through coupled enzymatic reactions

    • Allows continuous spectrophotometric monitoring of activity

A comprehensive assay setup would typically include reaction mixtures containing:

  • Buffer (often Tris-HCl, pH 8.0)

  • Divalent cations (Mg2+ at ~4mM concentration)

  • Substrates (CDP-DAG and PG at defined concentrations)

  • Purified recombinant Cls or membrane fractions containing the enzyme

  • Appropriate controls (heat-inactivated enzyme, reactions lacking individual substrates)

Analysis should include detailed characterization of reaction kinetics, substrate specificity, and cofactor requirements to fully validate the functionality of the recombinant enzyme.

How do substrate concentrations and reaction conditions affect P. aeruginosa Cls activity?

The activity of P. aeruginosa Cls is significantly influenced by substrate concentrations and reaction conditions, which must be optimized for reliable characterization:

  • Substrate concentration effects:

    • CDP-DAG and PG concentrations typically exhibit Michaelis-Menten kinetics with potential substrate inhibition at high concentrations

    • Optimal substrate ratios may differ from equimolar, requiring empirical determination

    • The presence of detergents or lipid environments can dramatically alter apparent Km values

  • Buffer composition influence:

    • pH optimum: Typically in the range of 7.5-8.5 for bacterial Cls enzymes, with significant activity reduction outside this range

    • Ionic strength: Moderate salt concentrations (50-150 mM) generally support optimal activity

    • Buffer selection: Tris, HEPES, or phosphate buffers at 50-100 mM are commonly used

  • Divalent cation requirements:

    • Mg2+ is typically essential, with optimal concentrations around 4-10 mM

    • Other divalent cations (Ca2+, Mn2+) may substitute but usually with altered activity profiles

  • Temperature and incubation time:

    • Temperature optima typically range from 30-37°C for P. aeruginosa enzymes

    • Reaction progress is generally linear only during initial phases (10-20 minutes)

  • Detergent effects:

    • Type and concentration of detergents dramatically influence activity

    • Detergent concentration must be above CMC but not so high as to denature the enzyme

    • Some detergents may compete with substrates for binding sites

For in vitro assays, researchers commonly use conditions that include 50 mM Tris/HCl (pH 8.0), 4.0 mM MgCl2, and substrate concentrations in the micromolar to low millimolar range, with incubation times of 20-30 minutes at 30-37°C . Systematic variation of these parameters is essential to determine optimal conditions specific to P. aeruginosa Cls.

How can researchers differentiate between cardiolipin synthase activity and other phospholipid-modifying enzymes in complex samples?

Differentiating cardiolipin synthase activity from other phospholipid-modifying enzymes in complex samples requires specific methodological approaches:

  • Substrate specificity verification:

    • Use of defined substrates: Cls specifically requires both CDP-DAG and PG as substrates

    • Control reactions omitting either CDP-DAG or PG should show no cardiolipin formation

    • Comparison of activity with structural analogs can confirm specificity

  • Product characterization:

    • TLC analysis with cardiolipin-specific staining (e.g., molybdenum blue)

    • Mass spectrometry to confirm the molecular structure of the product

    • Comparison with authentic cardiolipin standards

  • Selective inhibition:

    • Use of specific Cls inhibitors or antibodies against Cls

    • Differential sensitivity to inhibitors compared to other phospholipid-modifying enzymes

  • Genetic approaches:

    • Analysis of activity in samples from Cls knockout or overexpression strains

    • Comparison of activity patterns between wild-type and mutant samples

  • Subcellular fractionation:

    • Separation of different membrane fractions to isolate Cls-containing compartments

    • Correlation of activity with Cls protein levels in different fractions

A particularly robust approach is to combine substrate specificity with product verification. For example, researchers have used recombinant LPGAT1 (lysophosphatidylglycerol acyltransferase) to generate [14C]PG that was then specifically used by CLS to produce radiolabeled cardiolipin only in the presence of both CDP-DAG and [14C]PG . This two-enzyme system helps distinguish true Cls activity from other phospholipid-modifying enzymes that might be present in complex biological samples.

What structural features are critical for P. aeruginosa Cls function?

Several key structural features are critical for P. aeruginosa Cls function, though detailed structural information specific to P. aeruginosa Cls remains limited:

  • Catalytic domains and active site architecture:

    • Based on homology to other bacterial cardiolipin synthases, P. aeruginosa Cls likely contains phospholipase D (PLD)-like domains with conserved HxK(x)4D motifs critical for catalysis

    • The active site is likely formed by contributions from two PLD domains (PLD1 and PLD2) with conserved histidine residues serving as nucleophiles in the transphosphatidylation reaction

    • Mutations in these conserved residues would be expected to abolish enzymatic activity

  • Transmembrane regions:

    • As an integral membrane protein, P. aeruginosa Cls contains multiple transmembrane helices that anchor it within the membrane

    • These transmembrane domains position the catalytic site appropriately relative to the membrane surface where substrates are located

    • Proper folding and membrane integration of these regions is essential for function

  • Substrate binding pockets:

    • Distinct binding sites for CDP-DAG and PG are necessary

    • The spatial arrangement of these binding sites must facilitate phosphatidyl transfer

    • Specific residues involved in recognizing the headgroups and acyl chains of the substrate lipids

  • Oligomerization interfaces:

    • Some cardiolipin synthases function as dimers or higher-order oligomers

    • Proper quaternary structure may be essential for catalytic activity

  • Regulatory elements:

    • Domains or motifs that respond to environmental conditions or interact with regulatory proteins

    • These elements may modulate enzyme activity in response to physiological demands

Mutational studies in related bacterial systems have demonstrated that alterations in specific residues, particularly those in the N-terminal transmembrane region, the linker region connecting transmembrane helices to catalytic domains, and regions proximal to the PLD1 catalytic site, can significantly affect enzyme activity and function . These findings provide valuable guidance for structure-function studies of P. aeruginosa Cls.

How do membrane composition and lipid environment affect the activity of recombinant P. aeruginosa Cls?

The membrane composition and lipid environment profoundly influence recombinant P. aeruginosa Cls activity through multiple mechanisms:

  • Lipid-protein interactions:

    • Specific phospholipids, particularly anionic species like phosphatidylglycerol, can enhance Cls activity through direct interactions with the enzyme

    • The presence of cardiolipin itself may exert feedback regulation on enzyme activity

    • Membrane thickness and fluidity affect enzyme conformation and substrate accessibility

  • Substrate presentation and accessibility:

    • Lipid packing and lateral organization within membranes influence substrate diffusion rates

    • Domain formation in heterogeneous membranes may create microenvironments with altered substrate concentrations

    • The curvature of membrane surfaces, which is influenced by lipid composition, affects substrate presentation to the active site

  • Protein stability and conformation:

    • Specific lipid interactions stabilize the active conformation of Cls

    • Detergent micelles used for purification provide a suboptimal environment compared to native membranes

    • Reconstitution into liposomes of defined composition can restore activity lost during purification

  • Lateral pressure profile:

    • Different lipid species generate distinct lateral pressure profiles within the membrane

    • These pressure differences can alter protein conformation and catalytic efficiency

    • Spontaneous curvature of lipids influences enzyme conformation and activity

Experimentally, researchers can investigate these effects by:

  • Reconstituting purified Cls into liposomes of defined composition

  • Systematically varying lipid components to identify optimal environments

  • Comparing activity in detergent solutions versus reconstituted membrane systems

  • Using native membrane environments versus synthetic systems

Studies with other membrane-associated cardiolipin biosynthetic proteins have demonstrated that binding of cardiolipin is spontaneous and that these proteins show notable promiscuity in binding various molecular species . This suggests that P. aeruginosa Cls likely functions within a dynamic lipid environment where both specific and non-specific lipid-protein interactions modulate its activity.

What protein-protein interactions are important for Cls function in P. aeruginosa?

Several protein-protein interactions appear important for Cls function in P. aeruginosa, linking cardiolipin synthesis to broader membrane homeostasis systems:

  • Interactions with phospholipid transport proteins:

    • Cls likely interacts with components of phospholipid trafficking systems

    • The periplasmic phospholipid-binding protein Ttg2D, which can accommodate four acyl chains and bind cardiolipin, may interact with Cls directly or indirectly as part of the ABC transport system involved in maintaining outer membrane asymmetry

    • These interactions could coordinate cardiolipin synthesis with its subsequent transport and distribution

  • Maintenance of lipid asymmetry (Mla) system components:

    • Recent research indicates functional connections between Cls and the Mla system

    • MlaY, MlaZ, and MlaA proteins appear to be involved in cardiolipin degradation, suggesting potential regulatory interactions with synthesis pathways

    • Mutations in MlaY and MlaZ affect cardiolipin stability and sphingosine resistance, indicating these interactions are physiologically significant

  • Respiratory chain complexes:

    • In many bacteria, cardiolipin associates tightly with respiratory chain complexes

    • Cls may interact with components of the electron transport chain to coordinate cardiolipin synthesis with respiratory activity

    • These interactions could form the basis of regulatory mechanisms responding to cellular energy status

  • Cell division machinery:

    • Cardiolipin is enriched at cell poles and division sites in many bacteria

    • Potential interactions between Cls and division proteins could ensure proper cardiolipin localization during cell division

  • Stress response proteins:

    • Under stress conditions, Cls activity may be modulated through interactions with stress response proteins

    • These interactions could adapt membrane composition to environmental challenges

Methodologically, these interactions can be studied through approaches such as bacterial two-hybrid screens, co-immunoprecipitation followed by mass spectrometry, chemical crosslinking, or fluorescence resonance energy transfer (FRET) studies with fluorescently labeled proteins. Genetic approaches examining synthetic phenotypes between cls mutations and mutations in other membrane-related genes can also provide valuable insights into functional interactions.

A.1 How does cardiolipin synthesis contribute to P. aeruginosa antibiotic resistance?

Cardiolipin synthesis plays multifaceted roles in P. aeruginosa antibiotic resistance through several interconnected mechanisms:

  • Membrane permeability barrier enhancement:

    • Cardiolipin contributes to membrane rigidity and decreased permeability

    • Its unique structure with four acyl chains creates tightly packed membrane domains

    • These properties limit the passive diffusion of hydrophilic antibiotics across the membrane

    • Research on bacterial membrane composition suggests that alterations in cardiolipin content correlate with changes in antibiotic susceptibility

  • Interaction with the Mla system:

    • Recent findings show connections between cardiolipin metabolism and the maintenance of lipid asymmetry (Mla) system

    • Mutants of MlaY and MlaZ in P. aeruginosa show altered cardiolipin degradation and resistance to antimicrobial compounds like sphingosine

    • This suggests that cardiolipin's role in maintaining outer membrane asymmetry is crucial for defense against certain antimicrobials

  • Membrane potential and electrochemical gradient maintenance:

    • Cardiolipin influences membrane potential, which affects the activity of many antibiotics

    • Aminoglycosides require a membrane potential for uptake, so cardiolipin-mediated alterations can affect their efficacy

    • Cardiolipin's interaction with respiratory chain complexes may modulate the proton motive force, affecting antibiotic uptake

  • Stress response coordination:

    • Cardiolipin synthesis increases under certain stress conditions

    • This response may help protect bacteria during antibiotic exposure

    • Coordination between stress response systems and membrane remodeling contributes to adaptive resistance

  • Biofilm formation enhancement:

    • Cardiolipin may influence P. aeruginosa biofilm formation and architecture

    • Biofilms are inherently more resistant to antibiotics than planktonic cells

    • Cardiolipin's role in cell-to-cell interactions could affect community behavior

Unlike observations in Enterococcus species where specific mutations in Cls are associated with daptomycin resistance , direct mutations in P. aeruginosa Cls have not been as clearly linked to specific antibiotic resistance phenotypes. Instead, the role of cardiolipin in P. aeruginosa antibiotic resistance appears to be more integrated with broader membrane homeostasis systems and stress responses.

A.2 What is the relationship between cardiolipin synthesis and P. aeruginosa virulence?

The relationship between cardiolipin synthesis and P. aeruginosa virulence is complex and multifaceted, involving several interconnected mechanisms:

  • Membrane integrity and stress resistance:

    • Cardiolipin contributes to membrane stability under various stress conditions encountered during infection

    • Enhanced stress resistance improves bacterial survival within the host environment

    • The ability to maintain membrane function under stress is critical for persistent infections

  • Resistance to host antimicrobial defenses:

    • Recent research shows that sphingosine, an antimicrobial lipid present on respiratory epithelial cells, kills P. aeruginosa by inducing cardiolipin degradation via the Mla system

    • This demonstrates direct interaction between host defense mechanisms and bacterial cardiolipin metabolism

    • Changes in cardiolipin synthesis or stability could affect susceptibility to host antimicrobial compounds

  • Biofilm formation and persistence:

    • Cardiolipin influences membrane properties that affect cell adhesion and aggregation

    • These properties are critical for biofilm formation, a key virulence trait of P. aeruginosa

    • Biofilms contribute to persistence in chronic infections, particularly in cystic fibrosis patients

  • Secretion system function:

    • P. aeruginosa relies on various secretion systems to deliver virulence factors

    • Membrane composition, including cardiolipin content, can affect the assembly and function of these complex membrane-spanning machinery

    • Altered secretion system efficiency would directly impact virulence factor delivery

  • Adaptation to host environments:

    • Different infection sites (respiratory tract, wounds, systemic infections) present distinct environments

    • Cardiolipin synthesis may be differentially regulated in response to these environments

    • This adaptation could optimize bacterial fitness in specific host niches

  • Interaction with the immune system:

    • Bacterial membrane lipids, including potentially cardiolipin, can be recognized by the host immune system

    • Changes in membrane composition may affect immune recognition and response

    • Modulation of cardiolipin synthesis could represent a strategy to evade immune detection

The specific mechanisms through which cardiolipin synthesis affects P. aeruginosa virulence remain areas of active investigation. The discovery that sphingosine induces a persisting degradation of cardiolipin by the Mla system leading to severe membrane changes in P. aeruginosa provides direct evidence linking cardiolipin metabolism to bacterial survival in the context of host-pathogen interactions .

A.3 How is cardiolipin synthesis regulated in P. aeruginosa under different environmental conditions?

Cardiolipin synthesis in P. aeruginosa exhibits sophisticated regulation in response to various environmental conditions, involving multiple levels of control:

  • Transcriptional regulation:

    • Environmental stressors (pH shifts, osmotic stress, nutrient limitation) trigger transcriptional changes in cls gene expression

    • Different growth phases show distinct patterns of cls expression, with potential upregulation during stationary phase

    • Oxygen availability affects cls expression, with altered regulation under anaerobic or microaerobic conditions relevant to infection environments

  • Post-translational modifications:

    • Cls activity may be modulated through direct modifications like phosphorylation

    • These modifications can rapidly adjust enzyme activity in response to changing conditions

    • The reversible nature of many post-translational modifications allows fine-tuning of cardiolipin synthesis

  • Substrate availability regulation:

    • Environmental conditions affect the availability of Cls substrates (CDP-DAG and PG)

    • Changes in upstream phospholipid biosynthetic pathways indirectly regulate cardiolipin synthesis

    • Membrane phospholipid composition serves as feedback for regulating synthesis rates

  • Integration with stress response systems:

    • Cardiolipin synthesis is coordinated with broader stress response systems

    • The stringent response, triggered during nutrient limitation, affects phospholipid metabolism including cardiolipin synthesis

    • Two-component regulatory systems likely sense environmental conditions and modulate cls expression

  • Spatial regulation:

    • Cardiolipin synthesis may be spatially regulated within the cell

    • Localization of synthesis machinery to specific membrane domains could respond to environmental cues

    • This spatial regulation would allow targeted membrane remodeling

  • Interaction with the Mla system:

    • Environmental conditions may affect the balance between cardiolipin synthesis and degradation

    • Recent research indicates that the Mla system is involved in cardiolipin degradation in P. aeruginosa

    • The functional relationship between synthesis (Cls) and degradation (Mla) systems likely responds to environmental conditions

Methodological approaches to study this regulation include transcriptional reporter assays, proteomics to identify post-translational modifications, lipidomics to analyze membrane composition changes, and genetic approaches examining regulatory mutants under different environmental conditions. The complexity of this regulation reflects the critical importance of appropriate cardiolipin levels for P. aeruginosa adaptation and survival in diverse environments.

How might targeting cardiolipin synthase serve as a novel therapeutic approach against P. aeruginosa infections?

Targeting cardiolipin synthase in P. aeruginosa presents a promising but complex therapeutic avenue that requires sophisticated research approaches:

  • Rational inhibitor design strategies:

    • Structure-based drug design targeting unique features of P. aeruginosa Cls

    • Development of non-competitive inhibitors that bind allosteric sites

    • Substrate analogs that compete for active site binding but resist catalysis

    • Covalent inhibitors that irreversibly modify catalytic residues

  • Mechanistic considerations for effective inhibition:

    • Partial inhibition may be sufficient to compromise membrane integrity

    • Complete inhibition might be required for bactericidal effects

    • Synergistic effects with existing antibiotics should be systematically evaluated

    • Temporal aspects of inhibition (sustained vs. pulse) may affect efficacy

  • Delivery challenges and solutions:

    • Inhibitors must penetrate the P. aeruginosa outer membrane barrier

    • Conjugation with siderophores or other bacterial uptake systems

    • Nanoparticle-based delivery systems to improve targeting

    • Exploitation of bacterial efflux pump inhibitors as co-therapeutics

  • Potential resistance mechanisms:

    • Compensatory upregulation of other phospholipid biosynthetic pathways

    • Mutations in cls that maintain function but prevent inhibitor binding

    • Increased efflux of inhibitory compounds

    • Adaptive membrane remodeling that maintains function with reduced cardiolipin

  • Exploitation of sphingosine-mediated cardiolipin degradation:

    • Recent research shows sphingosine kills P. aeruginosa by inducing cardiolipin degradation via the Mla system

    • This natural defense mechanism could be exploited therapeutically

    • Development of sphingosine analogs with enhanced stability or activity

    • Combinatorial approaches targeting both synthesis (Cls) and degradation (Mla) pathways

How do mutations in cls affect P. aeruginosa fitness in different infection microenvironments?

The impact of cls mutations on P. aeruginosa fitness across different infection microenvironments represents a complex research area requiring sophisticated experimental approaches:

  • Heterogeneous host environments:

    • Respiratory tract infections: Cls mutations may differently affect survival in mucus-rich environments versus epithelial cell attachment

    • Wound infections: Altered oxygen gradients and nutrient availability may select for specific cls variants

    • Systemic infections: Blood and tissue environments impose distinct pressures on membrane composition

    • Methodological approach: Site-specific isolation of P. aeruginosa during infection progression with temporal tracking of cls genotypes

  • Fitness trade-offs:

    • Quantitative fitness landscape analysis of cls mutations across environmental conditions

    • Identification of potential epistatic interactions between cls and other genes

    • Characterization of how specific mutations affect growth rates, stress resistance, and virulence factor production

    • Methodological approach: Competition assays between wild-type and cls mutants under controlled environmental conditions simulating infection microenvironments

  • Host defense interaction:

    • Differential susceptibility of cls mutants to host antimicrobial peptides

    • Altered interaction with sphingosine, which induces cardiolipin degradation via the Mla system

    • Changed recognition patterns by immune cells

    • Methodological approach: Ex vivo exposure of cls mutants to specific host defense components with survival and membrane integrity assessment

  • Biofilm development effects:

    • Impact of cls mutations on biofilm architecture and stability

    • Altered antibiotic tolerance in biofilm state

    • Changes in dispersal dynamics and chronic infection establishment

    • Methodological approach: Flow cell biofilm systems with confocal microscopy to analyze structural differences

  • Compensatory adaptation:

    • Identification of secondary mutations that restore fitness in cls mutants

    • Characterization of alternative phospholipid synthesis pathways that compensate for altered cardiolipin levels

    • Assessment of membrane remodeling capabilities

    • Methodological approach: Experimental evolution studies with cls mutants under infection-relevant conditions

This research area has significant clinical implications, as understanding how cls mutations affect fitness in different infection contexts could inform targeted therapeutic approaches. The recent finding that sphingosine-mediated killing involves cardiolipin degradation suggests that cls mutations might particularly affect P. aeruginosa survival in respiratory tract environments where sphingosine is normally abundant .

How does the interaction between cardiolipin synthase and the Mla system affect P. aeruginosa membrane homeostasis?

The interaction between cardiolipin synthase and the Maintenance of Lipid Asymmetry (Mla) system represents a cutting-edge research area with significant implications for understanding P. aeruginosa membrane homeostasis:

  • Coordinated regulation mechanisms:

    • Investigation of transcriptional co-regulation between cls and mla genes

    • Identification of shared regulatory elements responding to membrane stress

    • Characterization of potential protein-protein interactions between Cls and Mla components

    • Methodological approach: Chromatin immunoprecipitation, transcriptional reporter assays, and co-immunoprecipitation studies

  • Functional interplay in membrane lipid dynamics:

    • Mapping the spatial and temporal distribution of synthesis (Cls) and degradation (Mla) activities

    • Quantification of lipid fluxes between synthesis and degradation pathways

    • Assessment of how this balance responds to environmental perturbations

    • Methodological approach: Pulse-chase experiments with labeled phospholipid precursors combined with lipidomics analysis

  • Sphingosine-induced cardiolipin degradation:

    • Recent research shows sphingosine induces cardiolipin degradation via the Mla system, leading to bacterial death

    • Characterization of the molecular mechanisms by which sphingosine activates this process

    • Investigation of how Cls activity responds to sphingosine exposure

    • Methodological approach: Time-course analysis of membrane composition changes following sphingosine treatment

  • Membrane domain organization:

    • Analysis of how Cls and Mla activities contribute to membrane microdomain formation

    • Investigation of potential co-localization or segregation of these systems in the membrane

    • Assessment of how alterations in one system affect the spatial organization of the other

    • Methodological approach: Super-resolution microscopy of tagged Cls and Mla components

  • Implications for antimicrobial resistance:

    • Systematic analysis of how mutations affecting the Cls-Mla interaction influence antibiotic susceptibility

    • Characterization of resistance mechanisms that involve altered coordination between these systems

    • Development of combination strategies targeting both systems simultaneously

    • Methodological approach: Minimum inhibitory concentration determination in genetic backgrounds with varying Cls and Mla activities

The finding that mutants of MlaY and MlaZ show resistance to sphingosine-induced death and prevent cardiolipin degradation provides compelling evidence for functional interaction between these systems . This interaction likely represents a critical aspect of membrane homeostasis with significant implications for bacterial survival during host-pathogen interactions and antibiotic exposure.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.