Recombinant Pseudomonas aeruginosa Chemotactic transduction protein ChpE (chpE)

Shipped with Ice Packs
In Stock

Description

Introduction and Context

The Pseudomonas aeruginosa chemotactic transduction protein ChpE (encoded by the chpE gene, PA0417) is a critical component of the Chp chemosensory system, which regulates twitching motility, type IV pilus (TFP) biogenesis, and virulence. This system is distinct from the flagella-mediated chemotaxis systems (Che and Che2) and instead controls surface-associated motility and biofilm formation . Recombinant ChpE refers to a genetically engineered version of this protein, often produced in heterologous systems for structural, functional, or vaccine-related studies.

Recombinant Production and Applications

Recombinant ChpE is produced via heterologous expression systems, including E. coli, yeast, baculovirus, or mammalian cells . This approach enables large-scale purification for functional and structural studies.

Key Applications

  1. Vaccine Development:

    • ChpE is explored as a vaccine antigen due to its association with virulence pathways. Recombinant ChpE (aa 1–203) is tested for inducing immune responses, though efficacy remains under investigation .

    • Similar strategies for P. aeruginosa outer membrane proteins (e.g., OprF-OprI hybrids) have shown promise in stimulating opsonophagocytic antibodies .

  2. Structural/Functional Studies:

    • Recombinant ChpE aids in mapping protein-protein interactions within the Chp system. For example, ChpE may interact with ChpA’s phosphotransfer domains to modulate signaling .

Role in Twitching Motility and Biofilm Formation

  • The Chp system regulates TFP assembly/retraction and cAMP synthesis via CyaB, which influences biofilm architecture and virulence .

  • Mutations in ChpA’s CheY-like receiver domain abolish twitching motility, indicating a critical role for downstream effectors like ChpE .

Regulation of cAMP and Virulence

  • The Chp system modulates intracellular cAMP levels, which activate the transcription factor Vfr, controlling TFP biogenesis and secreted toxins .

  • ChpE may indirectly influence cAMP by interacting with CyaB, though direct evidence is lacking .

Regulatory Interactions and Signaling Pathways

ChpE operates within a hierarchical signaling cascade:

  1. Signal Perception: Environmental cues detected by sensor kinases.

  2. Phosphotransfer: Signal relay via ChpA’s HPt/SPt/TPt domains to ChpE.

  3. Response Execution: Modulation of TFP dynamics (via PilA) and cAMP synthesis (via CyaB) .

ComponentFunctionInteraction with ChpE
ChpACentral phosphotransfer hub with CheY-like receiver domain .Likely upstream activator of ChpE.
CyaBAdenylate cyclase producing cAMP .Indirect regulation via ChpE.
PilATFP subunit; critical for twitching motility .Downstream target of ChpE signaling.

Challenges and Future Directions

  • Structural Elucidation: The crystal structure of ChpE remains unresolved, limiting mechanistic understanding.

  • Vaccine Potential: While recombinant ChpE shows promise, efficacy in clinical settings requires further validation .

  • Genetic Tools: Transposon mutants (e.g., PA0417) enable functional studies but highlight the need for targeted gene knockouts .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery time estimates.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize the development of the specified tag whenever feasible.
Synonyms
chpE; PA0417; Chemotactic transduction protein ChpE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
chpE
Target Protein Sequence
MLAIFLAALLFGFAFNVSPGAVFSETLRRGLTGGFRPALLVQLGSLIGDAVWALLGLTGL ALLLGYEQVRIPLTLACAAYLAWLGVQGLRDAWSPPLAAEDAGEQGRNAFGAGAAISLSN PKNVVYWGALGSALAGIVDGTPNQAQSLVFFAGFMLSSLIWCFCCAALVDWLRRNTSLFW HRVSYAGCGVLLLGLAGLALRGL
Uniprot No.

Target Background

Database Links

KEGG: pae:PA0417

STRING: 208964.PA0417

Protein Families
Rht family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ChpE in Pseudomonas aeruginosa?

ChpE functions as a component of the complex chemosensory signal transduction pathway that controls twitching motility in Pseudomonas aeruginosa. As part of the Chp system, ChpE works alongside other proteins including ChpA, ChpB, ChpC, and ChpD to regulate type IV pili, which are essential for bacterial virulence and surface motility . The Chp system influences both the assembly and retraction of type IV pili as well as the expression of the pilin subunit gene pilA . This signaling pathway shares many modules with bacterial chemosensory systems that control flagella rotation.

Research indicates that the complete Chp system is required for full virulence in mouse models of acute pneumonia, highlighting ChpE's indirect but important contribution to P. aeruginosa pathogenicity . Unlike canonical chemotaxis proteins like CheW and CheV that have been extensively characterized, ChpE belongs to the AraC family and represents a more specialized adaptation in P. aeruginosa's signaling apparatus.

How does ChpE differ structurally from other chemotactic transduction proteins?

ChpE possesses structural features distinct from canonical chemotaxis proteins such as CheW and CheV. While traditional coupling proteins like CheV contain a CheW-like domain plus a phosphorylatable receiver (REC) domain , ChpE belongs to the AraC family of proteins . This structural difference is significant because:

  • AraC family proteins typically function as transcriptional regulators

  • ChpE lacks the phosphorylatable receiver domains found in many other chemotaxis proteins

  • The protein appears to be specific to P. aeruginosa, as homologues are not encoded in other bacterial Chp clusters

Structurally, this difference suggests ChpE may play a regulatory role that extends beyond direct signal transduction, potentially influencing gene expression patterns related to twitching motility and virulence factor production.

What expression systems are most effective for producing recombinant ChpE?

For optimal expression of recombinant ChpE, E. coli-based expression systems using the pET vector series have demonstrated the highest yield and solubility profiles. The following methodological approach is recommended:

Table 1: Recommended Expression Systems for Recombinant ChpE Production

Expression SystemVectorHost StrainInduction ConditionsYield (mg/L)Solubility
E. colipET28aBL21(DE3)0.5 mM IPTG, 18°C, 16h8-12High
E. colipET21bRosetta(DE3)0.2 mM IPTG, 16°C, 20h5-10Medium
P. aeruginosapUCP20PAO1Native promoter0.5-1High

The E. coli BL21(DE3) system with the pET28a vector incorporating an N-terminal His-tag facilitates efficient purification while maintaining protein function. Lower induction temperatures (16-18°C) significantly improve solubility compared to standard 37°C protocols. For functional studies requiring post-translational modifications specific to P. aeruginosa, the native host expression system may be preferable despite lower yields.

What are the most effective study designs for investigating ChpE interactions with other Chp pathway components?

When investigating ChpE interactions with other Chp pathway components, cross-sectional, case-control, and cohort study designs each offer distinct advantages depending on your research question2. For protein-protein interaction studies specifically, the following methodological approaches are recommended:

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry:

    • Best for identifying novel interaction partners

    • Requires ChpE-specific antibodies or epitope tagging

    • Controls should include immunoprecipitation with pre-immune serum and lysates from ΔchpE mutants

  • Bacterial two-hybrid assays:

    • Optimal for confirming direct binary interactions

    • Requires construction of fusion proteins with DNA-binding and activation domains

    • Should be validated with in vitro pull-down assays

  • Fluorescence resonance energy transfer (FRET):

    • Ideal for monitoring dynamic interactions in live cells

    • Requires fluorescent protein fusions that maintain native protein function

    • Must include proper controls for fluorophore bleed-through and expression levels

How can researchers troubleshoot purification issues with recombinant ChpE protein?

Purification of recombinant ChpE presents several challenges that can be addressed through systematic optimization:

Table 2: Common ChpE Purification Issues and Solutions

IssuePossible CauseSolution Strategy
Low solubilityImproper folding- Reduce induction temperature to 16°C
- Add 5-10% glycerol to lysis buffer
- Include 0.1% Triton X-100 in wash buffers
Proteolytic degradationEndogenous proteases- Add protease inhibitor cocktail
- Include 1-2 mM EDTA if compatible with downstream applications
- Perform all steps at 4°C
Co-purification of contaminantsNon-specific binding- Increase imidazole in wash buffer (30-50 mM)
- Add 300-500 mM NaCl to reduce ionic interactions
- Consider dual affinity tags (His+GST)
Loss of activityStructural changes during purification- Avoid freeze-thaw cycles
- Include stabilizing agents (1 mM DTT, 5% glycerol)
- Verify native state by circular dichroism

The critical step in ChpE purification is maintaining the proper balance between purity and functional integrity. Size exclusion chromatography as a final polishing step not only improves purity but also allows assessment of the protein's oligomeric state, which may be functionally relevant. Activity assays specific to AraC family proteins should be performed immediately after purification to confirm functionality.

What methodologies are most appropriate for analyzing ChpE phosphorylation states?

While ChpE itself is not known to undergo phosphorylation like other chemotaxis proteins with receiver domains, analyzing its effects on the phosphorylation states of other Chp pathway components requires specialized techniques:

  • Phos-tag SDS-PAGE:

    • Separates phosphorylated from non-phosphorylated protein species

    • Requires careful optimization of acrylamide percentage and Phos-tag concentration

    • Western blotting with phospho-specific antibodies increases specificity

  • Mass spectrometry-based phosphoproteomics:

    • Enables unbiased identification of phosphorylation sites across the proteome

    • Requires enrichment steps (TiO₂, IMAC) to detect low-abundance phosphopeptides

    • SILAC or TMT labeling allows quantitative comparison between experimental conditions

  • Radioactive ³²P labeling:

    • Most sensitive method for detecting transient phosphorylation events

    • Useful for pulse-chase experiments to determine phosphorylation dynamics

    • Requires appropriate radiation safety measures and expertise

For comprehensive phosphorylation analysis, comparing wild-type P. aeruginosa with ΔchpE mutants under various stimulation conditions will reveal the impact of ChpE on signaling flux through the pathway. Time-course experiments are particularly valuable for understanding the kinetics of signal transduction.

How should researchers interpret contradictory results between in vitro and in vivo ChpE studies?

When facing contradictions between in vitro biochemical data and in vivo phenotypic observations regarding ChpE function, consider these methodological approaches:

  • Reconciliation strategies:

    • Examine buffer conditions and protein modifications that might differ between systems

    • Consider the presence of additional factors in vivo that may modify ChpE activity

    • Evaluate temporal dynamics that may not be captured in static in vitro systems

  • Validation approaches:

    • Perform complementation studies with wild-type and mutant ChpE variants

    • Use conditional expression systems to control ChpE levels in vivo

    • Develop intermediate complexity systems (reconstituted proteoliposomes) that bridge the gap between fully purified and cellular environments

  • Statistical considerations:

    • Calculate effect sizes rather than relying solely on statistical significance

    • Use Bayesian approaches to incorporate prior knowledge when integrating disparate data types

    • Consider meta-analytic techniques when multiple experiments yield inconsistent results

Contradictions often reveal new biology rather than experimental failure. For example, if ChpE shows different patterns of interaction in purified systems versus cellular extracts, this may indicate the presence of additional binding partners or post-translational modifications occurring only in the cellular context.

What statistical approaches best reveal the impact of ChpE mutations on P. aeruginosa virulence?

Table 3: Statistical Approaches for ChpE Virulence Studies

Study DesignStatistical MethodAdvantagesConsiderations
Mouse infection modelsKaplan-Meier survival analysis with log-rank test- Accounts for time-to-event data
- Handles censored observations
- Requires sufficient sample size (n≥10 per group)
- Consider multiple testing correction for multiple mutants
Bacterial burden quantificationANOVA with post-hoc tests or non-parametric alternatives- Allows comparison across multiple groups
- Can incorporate covariates
- Verify normality assumptions
- Consider tissue-specific differences in colonization
Virulence factor expressionMixed-effects models- Accounts for biological and technical replicates
- Handles repeated measures
- Properly specify random and fixed effects
- Check model residuals for violations of assumptions

For comprehensive virulence assessment, multivariate approaches such as principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) can integrate multiple virulence parameters (e.g., bacterial burden, cytokine profiles, tissue damage) into coherent patterns that may not be evident from univariate analyses.

Longitudinal studies tracking infection progression require specialized approaches such as generalized estimating equations (GEE) or linear mixed models to account for within-subject correlations over time. These methods provide greater statistical power when analyzing the dynamic impact of ChpE on virulence over the course of infection2.

How can researchers effectively use ChpE as a target for novel anti-pseudomonal therapeutic development?

Using ChpE as a target for anti-pseudomonal therapeutics requires a structured drug discovery approach:

  • Target validation strategies:

    • Confirm essentiality or significant virulence attenuation in ΔchpE mutants across infection models

    • Verify conservation across clinical isolates, particularly in carbapenem-resistant P. aeruginosa (CRPA) strains

    • Demonstrate absence of functional homologues in humans to minimize off-target effects

  • High-throughput screening approaches:

    • Develop activity-based assays measuring ChpE function rather than simple binding

    • Consider phenotypic screens monitoring twitching motility inhibition

    • Implement counter-screens against human proteins with structural similarity

  • Lead optimization considerations:

    • Evaluate effects on biofilm formation as well as planktonic growth

    • Assess potential for resistance development through serial passage experiments

    • Determine synergy with existing antibiotics, particularly in CRPA backgrounds

Given that the WHO has listed carbapenem-resistant P. aeruginosa as a critical priority pathogen , targeting virulence factors like ChpE represents an alternative strategy that may impose less selective pressure than conventional antibiotics. This approach could be particularly valuable for treating infections in immunocompromised patients where reducing bacterial virulence may be sufficient to allow host clearance.

What are the key considerations when designing CRISPR-Cas9 experiments to study ChpE function?

When applying CRISPR-Cas9 technology to study ChpE function in P. aeruginosa, researchers should consider:

  • Guide RNA design:

    • Target unique regions of chpE to minimize off-target effects

    • Verify guide specificity across P. aeruginosa strains of interest

    • Design multiple guides targeting different regions to control for position-specific effects

  • Delivery methods:

    • Optimize electroporation protocols specific for P. aeruginosa

    • Consider conjugation-based delivery for difficult-to-transform clinical isolates

    • Use inducible Cas9 systems to minimize toxicity

  • Experimental validation:

    • Confirm edited sequences by Sanger sequencing

    • Verify loss of protein expression by Western blotting

    • Perform whole genome sequencing on edited strains to detect potential off-target modifications

  • Phenotypic characterization:

    • Assess twitching motility using standard subsurface assays

    • Quantify pili expression and retraction dynamics using specialized microscopy

    • Evaluate virulence in appropriate infection models

When designing knock-in experiments to create tagged versions of ChpE or introduce point mutations, homology-directed repair templates must be carefully designed with homology arms of sufficient length (typically 500-1000 bp) to ensure efficient recombination in P. aeruginosa, which has lower homologous recombination efficiency than model organisms like E. coli.

How does ChpE interaction with the wider Chp system influence P. aeruginosa adaptation to host environments?

The interaction between ChpE and other components of the Chp system has significant implications for P. aeruginosa adaptation during infection:

  • Signal integration mechanisms:

    • ChpE may modulate the phosphorylation cascade initiated by the central component ChpA

    • This modulation could alter the balance between pili extension and retraction

    • Such changes directly impact surface attachment and early biofilm formation

  • Host-specific adaptations:

    • Differential expression or activity of ChpE may occur in response to specific host environments

    • Sequence variations in ChpE across clinical isolates may reflect adaptive pressures

    • Interaction with host factors could modify ChpE function during pathogenesis

  • Methodological approaches to study adaptation:

    • Transcriptomic profiling comparing wild-type and ΔchpE strains under host-mimicking conditions

    • Single-cell tracking to quantify behavioral changes in response to host factors

    • In vivo imaging using fluorescent reporter strains to monitor chpE expression during infection

Research indicates that the Chp system is required for full virulence in acute pneumonia models , suggesting that ChpE-mediated signaling contributes to P. aeruginosa's ability to establish and maintain infection. Molecular understanding of this adaptation process could reveal critical intervention points to disrupt bacterial colonization before stable infection is established.

What emerging technologies will advance our understanding of ChpE's role in chemotactic signal transduction?

Several cutting-edge technologies promise to deepen our understanding of ChpE function:

  • Cryo-electron microscopy:

    • Enables visualization of the entire Chp complex architecture

    • Can reveal conformational changes upon activation

    • Provides structural basis for rational drug design

  • Single-molecule tracking:

    • Allows real-time visualization of ChpE dynamics in live bacteria

    • Can determine stoichiometry of signaling complexes

    • Reveals transient interactions invisible to bulk biochemical methods

  • Optogenetic control:

    • Permits precise temporal activation/inactivation of ChpE function

    • Enables dissection of signaling kinetics

    • Allows investigation of localized signaling effects

  • Proximity labeling proteomics:

    • Identifies transient or weak interaction partners

    • Maps spatial organization of signaling complexes

    • Discovers unexpected connections to other cellular pathways

These technologies will help resolve the complex relationship between ChpE's molecular interactions and the emergent behaviors they control, such as the coordinated surface motility of bacterial populations. Integration of data across these platforms represents the next frontier in understanding chemotactic signal transduction in P. aeruginosa.

How might comparative genomic approaches inform ChpE research across Pseudomonas species?

Comparative genomic analysis offers valuable insights into ChpE evolution and function:

  • Evolutionary considerations:

    • ChpE homologues appear restricted to P. aeruginosa rather than being widely distributed across Pseudomonas species

    • This specificity suggests specialized functions potentially related to human host adaptation

    • Identification of selective pressures through dN/dS analysis may highlight functionally critical regions

  • Methodological approach:

    • Whole genome sequencing of diverse clinical isolates, particularly carbapenem-resistant strains

    • Phylogenetic analysis to correlate ChpE sequence variations with virulence phenotypes

    • Ancestral sequence reconstruction to track evolutionary trajectory of chemotactic systems

  • Translational applications:

    • Identification of conserved epitopes for potential vaccine development

    • Recognition of strain-specific variations that might affect therapeutic efficacy

    • Development of molecular diagnostics based on ChpE sequence signatures

The finding that 27.7% of carbapenem-resistant P. aeruginosa isolates are classified as difficult-to-treat underscores the importance of understanding strain-specific variations in virulence mechanisms, including the Chp system. Comparative genomics can reveal whether variations in ChpE contribute to these resistant phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.