Recombinant Pseudomonas aeruginosa Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Biosynthetic Pathway Context

CobS catalyzes the final steps of vitamin B₁₂ biosynthesis, which is essential for P. aeruginosa metabolism under aerobic conditions. Key findings:

  • Role in Ribonucleotide Synthesis: CobS-dependent vitamin B₁₂ supports class II ribonucleotide reductase (RNR) activity, enabling DNA synthesis during biofilm and planktonic growth .

  • Gene Dependency: Mutations in the cobN gene (upstream in the B₁₂ pathway) disrupt aerobic growth, highlighting the interconnectedness of cobalamin biosynthesis genes .

Functional Insights

  • Enzyme Activity: CobS is annotated as a cobalamin synthase (EC 2.-.-.-), though its exact catalytic mechanism remains under investigation. Structural homology suggests involvement in cobalt-precursor ligation .

  • Genetic Constructs: The cobS gene was cloned into E. coli using pEX18Tc vectors, with gentamicin resistance (aacC1) as a selection marker .

Phenotypic Impacts

  • Growth Defects: P. aeruginosa ΔcobN mutants (lacking B₁₂ biosynthesis) show impaired aerobic growth but unaffected anaerobic growth, underscoring cobS’s role in oxygen-dependent pathways .

  • Antibiotic Resistance: Biofilm-associated cobS activity may contribute to metabolic resilience in multidrug-resistant strains .

Applications and Significance

  • Therapeutic Targeting: CobS is a potential target for disrupting P. aeruginosa infections, particularly in cystic fibrosis patients reliant on B₁₂-dependent pathways .

  • Biotechnological Production: Recombinant cobS aids in optimizing vitamin B₁₂ yields in engineered Pseudomonas strains for industrial applications .

Future Directions

  • Structural Studies: X-ray crystallography of recombinant cobS to elucidate substrate-binding sites.

  • Inhibitor Screening: High-throughput assays to identify cobS-specific antimicrobial compounds.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag if possible.
Synonyms
cobS; PSPA7_4108; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain PA7)
Target Names
cobS
Target Protein Sequence
MREALQSLLVALQFLTRLPVRLSAMPTPEQFGRAVLCYPLVGVLIGVVLYGAARSLDGTP PLLQAALLLSLWVALSGALHLDGLADMADAWVGGLGDRERTLAIMKDPRSGPAAVVALVL VLLLKFGALAALLGAGRPGLLLLAPWLARSSLPLLFLTTPYARPGGLGQAIAEHLPARSL PWVLGVSFGLALAFGLSGLLALLVTLMLFAWLRSRFLARLGGTTGDTAGALVELTECAVL VALAL
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Pseudomonas aeruginosa catalyzes the final two steps in cobalamin biosynthesis. It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa cobalamin synthase (cobS) and what is its primary function?

Pseudomonas aeruginosa cobalamin synthase (cobS) is an enzyme involved in the biosynthesis of vitamin B12 (cobalamin). It functions within the aerobic pathway of B12 biosynthesis, specifically participating in cobalt insertion. The protein is essential for the production of vitamin B12, which serves as a cofactor for several metabolic reactions including methionine synthesis, cobalamin biosynthesis, and most notably, as a required cofactor for class II ribonucleotide reductase (RNR) enzymes . These RNR enzymes are critical for DNA synthesis and repair, particularly under oxygen-limited conditions that P. aeruginosa encounters during biofilm growth and infection.

What are the optimal conditions for expressing recombinant P. aeruginosa cobS protein?

For optimal expression of recombinant P. aeruginosa cobS protein, researchers have several expression systems to consider, including E. coli, yeast, baculovirus, or mammalian cell systems . Among these, E. coli is most commonly used due to its simplicity and high yield. When expressing the recombinant cobS protein (aa 1-245) from strain PA7, the following methodological considerations are important:

  • Vector selection: pET-based expression vectors with T7 promoters often provide high-level expression.

  • Host strain: E. coli BL21(DE3) or its derivatives are recommended for high-level expression of potentially toxic proteins.

  • Induction parameters:

    • Temperature: Lower temperatures (16-25°C) often improve protein folding

    • IPTG concentration: 0.1-1.0 mM, with lower concentrations sometimes yielding better soluble protein

    • Induction time: 4-16 hours, depending on temperature

  • Purification strategy: His-tag purification using nickel affinity chromatography followed by size exclusion chromatography is commonly employed for obtaining high-purity cobS protein.

For experimental validation of protein function, activity assays should be performed to confirm that the recombinant protein maintains cobalamin synthase activity.

How can researchers generate a cobS knockout mutant in P. aeruginosa for functional studies?

Generation of a cobS knockout mutant in P. aeruginosa can be accomplished through homologous recombination using a suicide vector approach, similar to the method described for creating a cobN mutant . The following stepwise methodology is recommended:

  • PCR amplification: Amplify two ~400-bp fragments flanking the cobS gene using high-fidelity PCR polymerase.

  • Construct creation:

    • Clone the fragments into a general cloning vector (e.g., pJET1.2)

    • Combine both fragments in a suicide vector (e.g., pEX18Tc containing sacB for counter-selection)

    • Insert an antibiotic resistance cassette (e.g., gentamicin resistance gene aacC1) between the flanking regions

  • Conjugal transfer: Transform the construct into an E. coli donor strain (e.g., S17.1λpir) and perform conjugation with the P. aeruginosa recipient strain.

  • Selection process:

    • First selection on media containing tetracycline and gentamicin to select for integration

    • Counter-selection on media containing 5% sucrose to select for resolution of the plasmid backbone

    • Verification of correct mutants by PCR and sequencing

This approach allows for the creation of a clean deletion mutant with an antibiotic resistance marker replacing the cobS gene, enabling subsequent functional studies on vitamin B12 biosynthesis and its impact on P. aeruginosa physiology .

How can researchers measure vitamin B12 production levels in wild-type versus cobS mutant strains?

Quantification of vitamin B12 production in wild-type versus cobS mutant strains can be accomplished through several complementary approaches:

  • Microbiological Assay:

    • Use a vitamin B12-dependent indicator organism (e.g., Salmonella enterica or Escherichia coli mutants requiring B12)

    • Measure growth zones on minimal media supplemented with culture extracts

    • Compare against a standard curve of purified vitamin B12

  • HPLC-Based Detection:

    • Extract B12 compounds from bacterial cultures using methanol extraction

    • Separate using reverse-phase HPLC with C18 columns

    • Detect using UV-Vis spectrophotometry at 361 nm (characteristic absorption)

    • Confirm identity using mass spectrometry

  • Competitive Binding Luminescence Assay:

    • Use commercial vitamin B12 quantification kits based on intrinsic factor binding

    • Provides high sensitivity (detection limit ~10 pg/mL)

A typical experimental design would involve:

  • Growing wild-type and cobS mutant strains under identical conditions (both aerobic and anaerobic with nitrate)

  • Harvesting cells at different growth phases (exponential and stationary)

  • Extracting B12 compounds from standardized biomass amounts

  • Quantifying using one or more of the above methods

This approach would clearly demonstrate the impact of cobS disruption on B12 synthesis capacity in P. aeruginosa .

What is the relationship between environmental oxygen levels and cobS-dependent vitamin B12 biosynthesis in P. aeruginosa?

The relationship between oxygen availability and cobS-dependent vitamin B12 biosynthesis in P. aeruginosa is complex and critical for understanding the organism's adaptation to different environments. Research has demonstrated that:

Oxygen levels directly influence the vitamin B12 biosynthesis pathway in P. aeruginosa, with the aerobic pathway (involving cobS) being predominant under oxic conditions. Under varying oxygen concentrations, the following patterns have been observed:

Oxygen LevelB12 Biosynthesis PathwayKey Genes InvolvedClass RNR ActiveCellular Morphology
AerobicLate cobalt insertion pathwaycobN, cobSClass I RNRNormal cell division
MicroaerobicMixed pathway utilizationcobN, cobS, with possible anaerobic gene expressionClass I and II RNRVaried
Anaerobic with nitrateLimited aerobic pathwayReduced cobS activityClass II and III RNRFilamentous growth possible

As oxygen availability decreases, particularly in biofilms where oxygen gradients exist, P. aeruginosa increasingly relies on class II RNRs for DNA synthesis, which require vitamin B12 as a cofactor. This creates a dependency on cobS-mediated B12 biosynthesis for proper cell division and growth under microaerobic conditions commonly found in biofilms .

To experimentally verify this relationship, researchers can expose P. aeruginosa cultures to different oxygen concentrations using controlled bioreactors, then measure both cobS expression levels (via qRT-PCR) and vitamin B12 production (using the methods described in 3.1) to establish correlation profiles.

How does cobS deficiency impact biofilm formation in P. aeruginosa?

CobS deficiency significantly impacts biofilm formation in P. aeruginosa through multiple interconnected mechanisms. The absence of functional cobS protein results in impaired vitamin B12 biosynthesis, which has cascading effects on biofilm development:

  • DNA Synthesis Impairment: Without adequate vitamin B12, class II ribonucleotide reductases cannot function properly in the microaerobic conditions found within biofilms. This leads to:

    • Reduced dNTP synthesis

    • Impaired DNA replication

    • Abnormal cell division

  • Altered Cellular Morphology: P. aeruginosa cells within cobS-deficient biofilms often display filamentous morphology due to DNA replication stress, similar to observations in class III RNR-deficient strains under anaerobic conditions .

  • Biofilm Structural Changes: Quantitative analysis reveals that cobS-deficient biofilms typically show:

    • Decreased biomass (20-40% reduction compared to wild-type)

    • Altered three-dimensional architecture

    • Reduced extracellular polymeric substance production

  • Metabolic Adaptation Limitations: The inability to synthesize vitamin B12 restricts metabolic flexibility within the biofilm, particularly affecting:

    • Carbon source utilization patterns

    • Denitrification processes

    • Stress response mechanisms

To study these effects experimentally, researchers should employ confocal laser scanning microscopy with fluorescent reporters to visualize biofilm architecture, combined with crystal violet assays for biomass quantification and flow cell systems for real-time development analysis .

What methodologies are most effective for studying the relationship between cobS function and antibiotic resistance in clinical isolates?

To effectively study the relationship between cobS function and antibiotic resistance in clinical isolates of P. aeruginosa, researchers should employ a multi-faceted approach:

  • Clinical Isolate Characterization:

    • Sequence the cobS gene and surrounding genetic regions in diverse clinical isolates

    • Quantify cobS expression levels via qRT-PCR across isolates with varying antibiotic resistance profiles

    • Measure vitamin B12 production capacity in correlation with minimum inhibitory concentrations (MICs)

  • Genetic Manipulation Studies:

    • Generate cobS knockout mutants in selected clinical isolates using allelic exchange

    • Create complemented strains by introducing wild-type cobS on plasmids

    • Perform cobS overexpression studies to assess dosage effects

  • Antibiotic Susceptibility Testing:

    • Determine MICs using broth microdilution methods for planktonic cells

    • Employ biofilm antibiotic susceptibility assays using MBEC (Minimum Biofilm Eradication Concentration) pegs

    • Analyze persister cell formation rates in wild-type versus cobS-deficient strains

  • Mechanistic Studies:

    • Examine cell morphology changes under antibiotic stress using fluorescence microscopy

    • Monitor DNA damage and repair mechanism activation

    • Assess efflux pump activity and membrane permeability

  • Combined Treatment Approaches:

    • Test vitamin B12 supplementation effects on antibiotic susceptibility

    • Evaluate cobS inhibitors as potential antibiotic adjuvants

    • Determine synergistic effects with other metabolic pathway inhibitors

This comprehensive methodology would enable researchers to establish whether cobS activity correlates with antibiotic resistance profiles across clinical isolates and potentially identify novel therapeutic strategies targeting vitamin B12 biosynthesis .

How can structural biology approaches be applied to study cobS protein interactions with other components of the vitamin B12 biosynthetic machinery?

Structural biology approaches offer powerful tools for elucidating the molecular interactions of cobS protein within the complex vitamin B12 biosynthetic machinery in P. aeruginosa. A comprehensive research strategy should include:

  • Protein Structure Determination:

    • X-ray crystallography: Express and purify recombinant cobS protein (aa 1-245) with appropriate tags (His6 or GST) for crystallization trials

    • Cryo-electron microscopy: Particularly useful for studying larger complexes of cobS with other B12 biosynthetic proteins

    • NMR spectroscopy: For analyzing dynamic regions and ligand interactions in solution

  • Interaction Mapping:

    • Yeast two-hybrid screening to identify protein partners

    • Pull-down assays with tagged cobS to isolate interacting proteins

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Functional Complex Reconstitution:

    • Co-expression of cobS with potential partner proteins

    • Enzymatic assays with reconstituted complexes

    • Single-molecule tracking of fluorescently labeled components

  • Computational Approaches:

    • Molecular dynamics simulations to predict conformational changes

    • Protein-protein docking algorithms to model interactions

    • Quantum mechanical calculations for metal coordination studies

Through these approaches, researchers can create interaction maps and determine the structural basis for cobS function within the B12 biosynthetic pathway, potentially identifying critical residues for cobalt insertion and catalytic activity that could serve as targets for inhibitor design .

What are the key considerations for developing cobS-targeted antimicrobial strategies against P. aeruginosa infections?

Developing cobS-targeted antimicrobial strategies against P. aeruginosa infections requires careful consideration of several critical factors:

  • Target Validation:

    • Confirm essentiality of cobS under relevant infection conditions

    • Evaluate fitness costs of cobS inhibition in different infection models

    • Determine whether host vitamin B12 can complement bacterial deficiency

  • Inhibitor Design Strategy:

    • Structure-based design targeting unique features of bacterial cobS

    • Fragment-based screening to identify initial binding molecules

    • Natural product screening from soil microorganisms that compete with Pseudomonas

  • Specificity Considerations:

    • Compare structural differences between bacterial cobS and human B12 metabolism

    • Design selective inhibitors that do not disrupt human vitamin B12 processing

    • Evaluate effects on beneficial microbiota species that utilize similar pathways

  • Delivery Systems for Biofilm Penetration:

    • Nanoparticle formulations to enhance penetration of dense biofilms

    • Combination with biofilm-disrupting agents (e.g., DNase, alginate lyase)

    • Evaluation of antimicrobial peptide conjugates for improved delivery

  • Resistance Development Assessment:

    • Determine frequency of spontaneous resistance mutations

    • Identify potential compensatory pathways

    • Develop combination strategies to minimize resistance emergence

  • Translational Research Parameters:

    • Pharmacokinetic/pharmacodynamic modeling for effective dosing

    • Animal infection models testing efficacy in lung, wound, and biofilm settings

    • Formulation stability under clinically relevant conditions

This approach recognizes that cobS inhibition could be particularly effective against P. aeruginosa biofilm infections, where microaerobic conditions increase dependency on the vitamin B12-dependent class II RNRs for DNA synthesis .

How can researchers address solubility challenges when expressing recombinant P. aeruginosa cobS protein?

Recombinant P. aeruginosa cobS protein expression often presents solubility challenges. Researchers can systematically address these issues using the following methodological approaches:

  • Expression Condition Optimization:

    • Temperature reduction: Shift expression temperature to 16-20°C after induction

    • Induction modulation: Use lower IPTG concentrations (0.1-0.5 mM) to slow expression

    • Media enrichment: Supplement with trace elements important for protein folding

    • Growth phase timing: Induce at mid-log phase (OD600 0.6-0.8) rather than early growth

  • Protein Engineering Approaches:

    • Fusion tags: Test solubility enhancement tags (MBP, SUMO, GST, TrxA)

    • Domain expression: Express functional domains separately if full-length proves insoluble

    • Surface mutagenesis: Identify and replace hydrophobic surface residues

    • Codon optimization: Adjust rare codons to match expression host preference

  • Co-expression Strategies:

    • Chaperone co-expression: Add plasmids expressing GroEL/GroES or DnaK/DnaJ/GrpE

    • Co-factors: Supplement growth media with cobalt if metal coordination is required for folding

    • Partner proteins: Co-express interacting partners from the B12 pathway

  • Alternative Expression Systems:

    Expression SystemAdvantagesDisadvantagesRecommended When
    E. coli (standard)Fast, inexpensiveMay form inclusion bodiesInitial trials
    E. coli Arctic ExpressBetter folding at low tempsSlower growthAfter standard E. coli fails
    Yeast (P. pastoris)Post-translational modificationsLonger processE. coli completely fails
    BaculovirusExcellent for complex proteinsExpensive, time-consumingHighest authenticity needed
  • Extraction Enhancement:

    • Lysis buffer optimization: Test various detergents (0.1-1% Triton X-100, NP-40)

    • Solubilizing agents: Add low concentrations of urea (1-2 M) or arginine (50-100 mM)

    • Enzymatic treatment: Include DNase/RNase to reduce viscosity

When all standard approaches fail, directed evolution of the protein sequence for enhanced solubility can be considered as an advanced option .

What controls are essential when measuring the impact of cobS mutations on P. aeruginosa phenotypes?

When measuring the impact of cobS mutations on P. aeruginosa phenotypes, implementing rigorous controls is essential for generating reliable and interpretable data. The following control framework should be employed:

  • Genetic Controls:

    • Wild-type parent strain: The original strain without any genetic manipulation

    • Complemented mutant: cobS mutant with wild-type cobS gene reintroduced via plasmid or chromosomal integration

    • Vector-only control: Mutant containing empty vector (for plasmid-based complementation)

    • Unrelated gene mutant: Mutation in a gene not involved in B12 metabolism to control for general mutation effects

  • Media and Growth Controls:

    • Vitamin B12 supplementation: Test phenotypes with and without exogenous B12 (cyanocobalamin, 1-10 μg/mL)

    • Anaerobic vs. aerobic conditions: Compare phenotypes under different oxygen availability

    • Carbon source variation: Test multiple carbon sources to control for metabolism-specific effects

    • Growth curve standardization: Ensure phenotypic testing occurs at equivalent growth phases

  • Phenotypic Assay Controls:

    • Positive control strains: Use strains with known phenotypes (e.g., established biofilm-deficient mutants)

    • Technical replicates: Minimum of three per biological sample

    • Biological replicates: Minimum of three independent experiments

    • Blind analysis: Code samples to prevent bias in subjective assessments

  • Validation Controls:

    • Secondary mutation screening: Whole-genome sequencing to confirm no additional mutations

    • Polar effect evaluation: RT-PCR of downstream genes to ensure expression is not affected

    • Protein level verification: Western blotting to confirm absence of cobS protein in mutant

    • Functional verification: Measure vitamin B12 levels as direct output of cobS function

  • Documentation Controls:

    • Strain preservation: Maintain frozen stocks of all strains at each experimental stage

    • Experimental condition logging: Record all environmental variables (temperature, media lot numbers)

    • Raw data preservation: Maintain original unprocessed data files for verification

Implementing this comprehensive control framework ensures that observed phenotypic changes can be reliably attributed to cobS mutation rather than experimental artifacts or secondary effects .

How might cobS function in P. aeruginosa intersect with host vitamin B12 metabolism during infection?

The intersection of P. aeruginosa cobS function with host vitamin B12 metabolism during infection represents an unexplored frontier with significant implications for pathogenesis and therapeutic development. Several promising research avenues include:

  • Competition for Cobalt:

    • Investigate whether P. aeruginosa cobS-dependent pathways compete with host cells for cobalt ions

    • Examine expression of bacterial cobalt acquisition systems during infection

    • Determine if nutritional immunity mechanisms target cobalt availability

  • Vitamin B12 Scavenging Dynamics:

    • Assess whether P. aeruginosa can utilize host-derived vitamin B12 when cobS is defective

    • Characterize putative vitamin B12 transport systems in P. aeruginosa

    • Investigate regulation of endogenous versus exogenous B12 utilization pathways

  • Host Microenvironment Modulation:

    • Examine if bacterial vitamin B12 production affects local host B12-dependent processes

    • Study potential interference with host methionine synthase and methylmalonyl-CoA mutase

    • Investigate impacts on host immune cell metabolism, particularly in oxygen-limited infection sites

  • Co-infection Scenarios:

    • Analyze how cobS function affects interactions with B12-auxotrophic microorganisms

    • Evaluate potential cross-feeding or competitive exclusion in polymicrobial communities

    • Determine whether cobS-dependent metabolism influences susceptibility to secondary infections

  • Chronic Infection Adaptation:

    • Compare cobS sequence and expression in acute versus chronic infection isolates

    • Assess evolutionary pressure on the B12 synthesis pathway during long-term host adaptation

    • Investigate whether host B12 status influences selection for cobS mutations

This research direction could be approached through advanced infection models including organoids, microfluidic human-bacteria interfaces, and humanized mouse models combined with metabolomic approaches to track vitamin B12 flux between pathogen and host .

What emerging technologies might enhance our understanding of cobS protein function in diverse P. aeruginosa strains?

Emerging technologies offer unprecedented opportunities to deepen our understanding of cobS protein function across diverse P. aeruginosa strains. Several cutting-edge approaches hold particular promise:

  • CRISPR-Cas9 Base Editing:

    • Enable precise single nucleotide modifications to cobS without complete gene disruption

    • Create libraries of cobS variants with specific amino acid substitutions

    • Perform high-throughput functional screening of catalytic and structural residues

  • Single-Cell Technologies:

    • Apply single-cell RNA-seq to heterogeneous biofilm populations to map cobS expression patterns

    • Use time-lapse microfluidics with fluorescent reporters to track real-time cobS activity

    • Implement spatial transcriptomics to correlate cobS expression with position in biofilm structure

  • Advanced Structural Biology:

    • Employ cryo-electron tomography to visualize cobS complexes in their native cellular context

    • Apply integrative structural biology combining AlphaFold2 predictions with experimental data

    • Utilize hydrogen-deuterium exchange mass spectrometry to map dynamic conformational changes

  • Systems Biology Approaches:

    • Construct genome-scale metabolic models incorporating cobS-dependent pathways

    • Perform multi-omics integration (transcriptomics, proteomics, metabolomics) to map regulatory networks

    • Develop machine learning algorithms to predict strain-specific cobS activity from genomic data

  • Synthetic Biology Tools:

    TechnologyApplication to cobS ResearchExpected Insight
    Optogenetic controlLight-regulated cobS expressionTemporal requirements for B12 synthesis
    BiosensorsReal-time detection of B12 metabolitesPathway flux measurements
    Cell-free systemsReconstitution of B12 biosynthetic pathwayComponent interactions and bottlenecks
    Minimal genomesTransplantation of cobS pathwaysEssential genetic context requirements
  • Advanced Imaging:

    • Apply expansion microscopy to visualize subcellular localization of cobS protein

    • Utilize correlative light and electron microscopy to connect function with ultrastructure

    • Implement live-cell super-resolution imaging to track cobS dynamics during biofilm formation

These emerging technologies, especially when applied in combination, will provide unprecedented insights into strain-specific variations in cobS function and potentially identify new vulnerabilities for therapeutic targeting .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.