Recombinant Pseudomonas aeruginosa Cytochrome c-type biogenesis protein CcmH (ccmH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ccmH; PA1482; Cytochrome c-type biogenesis protein CcmH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-155
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
ccmH
Target Protein Sequence
AIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGE IVDYMVARYGDFVRYKPPVNERTWLLWFGPGALLLFGVLVIGVIVLRRRRTAAKVQTTLS AEEQARLANLLKNDK
Uniprot No.

Target Background

Function

Function: Essential for the biogenesis of c-type cytochromes. A potential subunit of a heme lyase.

Database Links

KEGG: pae:PA1482

STRING: 208964.PA1482

Protein Families
CcmH/CycL/Ccl2/NrfF family
Subcellular Location
Membrane; Single-pass membrane protein; Periplasmic side.

Q&A

What is CcmH and what role does it play in cytochrome c maturation?

CcmH is a membrane-associated protein and an essential component of the cytochrome c maturation (Ccm) System I found in Gram-negative bacteria like Pseudomonas aeruginosa. It functions as part of the CcmF/H complex (cytochrome synthetase) that catalyzes the final step of cytochrome c biogenesis - the covalent attachment of heme to the apocytochrome .
The maturation of cytochrome c occurs in the bacterial periplasm, where CcmH works in concert with other specialized thiol-disulfide oxidoreductases to ensure the correct reduction of oxidized apocytochrome before covalent heme attachment . CcmH contains a redox-active CX₂C motif that participates in thiol-disulfide exchange reactions critical for this process .

What is known about the structural characteristics of Pseudomonas aeruginosa CcmH?

Pseudomonas aeruginosa CcmH is a cytoplasmic membrane protein with a periplasmic domain that contains the functionally critical CX₂C motif. Research has established that CcmH has an N-terminal signal peptide that is cleaved during maturation .
Studies have employed various approaches to characterize CcmH structure, including the construction of hexahistidine-tagged versions of the protein - both full-length (CcmHSP) and a version lacking the N-terminal 21 amino acids (CcmHNSP) . These constructs have facilitated purification and structural analysis of the protein.
The functional importance of the CX₂C motif has been demonstrated through mutation studies, where deletion of the region encoding this motif (as in the ccmH1 allele) results in loss of function .

How does CcmH interact with other components of the cytochrome c maturation System I?

CcmH functions as part of an intricate protein machinery in System I, which in Escherichia coli consists of eight maturation proteins (CcmA-H) . The interactions between these components create a coordinated pathway for cytochrome c biogenesis:

  • CcmH forms a complex with CcmF (cytochrome synthetase) that catalyzes the final step of heme attachment to the apocytochrome .

  • CcmH interacts with CcmG, another thiol-disulfide oxidoreductase in the system. Research suggests that the physiological substrate of Pa-CcmG may be the mixed-disulfide complex between Pa-CcmH and apocytochrome .

  • The CcmF/H complex receives heme from holo-CcmE (heme chaperone) for transfer to the apocytochrome .

  • CcmH works in coordination with CcmG and CcdA (or DsbD) to ensure the reduction of the disulfide bond between cysteine residues in the heme-binding motifs (CXXCH) of the apocytochrome prior to heme attachment .

What experimental methods are commonly used to study CcmH function in Pseudomonas aeruginosa?

Several experimental approaches have been employed to study CcmH function:
Genetic Manipulation Techniques:

  • Construction of deletion mutants, such as the ccmH1 allele with a 291-bp deletion removing 97 codons including the CX₂C motif

  • Site-directed mutagenesis of specific residues to assess their functional importance

  • Creation of gene fusions to reporter proteins like alkaline phosphatase (PhoA) or β-galactosidase (LacZ) to study protein topology and localization
    Protein Characterization Methods:

  • Construction of hexahistidine-tagged versions for protein purification and analysis

  • X-ray crystallography for structural determination (as done with the related protein CcmG)

  • Redox potential and pKa measurements to understand the biochemical properties of the active site
    Functional Assays:

  • Mixed disulfide complex isolation to study protein-protein interactions

  • Measurements of cytochrome c production to assess maturation system efficiency

How can recombinant CcmH be expressed and purified for structural and functional studies?

Based on the methodologies described in the research literature, the following approach can be used:

  • Cloning Strategy:

    • Amplify the ccmH gene from Pseudomonas aeruginosa genomic DNA using PCR

    • Design primers with appropriate restriction sites (e.g., BamHI and HindIII) to facilitate cloning

    • Clone the PCR product into an expression vector like pQE30 for N-terminal His₆-tagging

  • Expression Constructs:

    • Full-length CcmH with signal peptide (CcmHSP)

    • CcmH without the N-terminal signal peptide (CcmHNSP)

  • Expression System:

    • Transform the constructs into an E. coli expression strain

    • Induce protein expression using appropriate conditions (e.g., IPTG induction)

  • Purification Protocol:

    • Lyse cells using appropriate buffer systems

    • Purify the His₆-tagged protein using nickel affinity chromatography

    • Further purify using size exclusion or ion exchange chromatography if needed

  • Quality Control:

    • Analyze purity by SDS-PAGE

    • Verify identity by Western blotting and/or mass spectrometry

    • Assess proper folding using circular dichroism or other biophysical techniques

What are the comparative features of cytochrome c biogenesis Systems I and II?

Researchers have conducted comparative studies between Systems I and II to understand their distinct mechanisms and characteristics:

FeatureSystem I (with CcmH)System II
ComponentsEight proteins (CcmA-H)Single fused CcsBA polypeptide
Heme chaperoneUses CcmE with covalently bound hemeNo covalent heme chaperone identified
Heme affinityCan utilize endogenous heme at much lower levelsRequires higher heme levels
Heme reservoirHolo-CcmE serves as a heme reservoirNo equivalent heme reservoir capability
DistributionFound in many Gram-negative bacteria and some mitochondriaPresent in Gram-positive bacteria, cyanobacteria, and chloroplasts
ComplexityMore complex systemSimpler system
This comparative analysis demonstrates that System I, which includes CcmH, has evolved specific capabilities for functioning in low-heme environments, using holo-CcmE as a heme reservoir .

How do mutations in the CX₂C motif of CcmH affect cytochrome c maturation?

The CX₂C motif (specifically 43CX₂C46 in Rhodobacter sphaeroides) is critical for CcmH function . Research involving site-directed mutagenesis and deletion analysis has revealed:

  • Deletion of the region containing the CX₂C motif results in complete loss of function, as demonstrated by the ccmH1 allele which contains a 291-bp deletion removing 97 codons including this motif .

  • The cysteine residues in this motif are involved in thiol-disulfide exchange reactions that are essential for the reduction of the CXXCH motif in apocytochromes prior to heme attachment.

  • Mutations that alter the redox properties of these cysteines affect the efficiency of cytochrome c maturation, potentially by disrupting the ability of CcmH to participate in electron transfer processes or to form mixed disulfides with partner proteins.

  • The redox state of the CX₂C motif is likely maintained by interaction with CcmG, as suggested by studies showing that Pa-CcmG may interact with Pa-CcmH via mixed disulfide complexes .

What is the relationship between CcmH and CcmG in the electron transfer pathway for cytochrome c maturation?

The functional relationship between CcmH and CcmG in the electron transfer pathway has been investigated through structural and biochemical studies:

  • CcmG from P. aeruginosa (Pa-CcmG) is a thioredoxin-like protein with a redox-active CXXC motif (specifically involving Cys74 and Cys77) .

  • The standard redox potential of Pa-CcmG has been determined to be E(0') = -0.213 V at pH 7.0, and the pKa values of its active site thiols are pKa = 6.13 ± 0.05 for the N-terminal Cys74 and pKa = 10.5 ± 0.17 for the C-terminal Cys77 .

  • Experiments to characterize the mixed disulfide complex between Pa-CcmG and Pa-CcmH suggest that the target disulfide of Pa-CcmG is not the intramolecular disulfide of oxidized Pa-CcmH, but rather an intermolecular disulfide formed between CcmH and substrate proteins .

  • This indicates that in vivo, the physiological substrate of Pa-CcmG may be the mixed-disulfide complex between Pa-CcmH and apocytochrome c, suggesting a sequential electron transfer pathway where CcmG reduces CcmH, which then reduces the apocytochrome .

How does the CcmF/H complex (cytochrome synthetase) coordinate heme delivery to apocytochromes?

The mechanism by which the CcmF/H complex coordinates heme delivery involves several steps and components:

  • Heme is initially transported across the cytoplasmic membrane by the CcmABCD complex and becomes covalently attached to CcmE to form holo-CcmE .

  • The CcmF/H complex (cytochrome synthetase) receives heme from holo-CcmE for the final transfer to the apocytochrome .

  • Prior to heme attachment, the CXXCH motif in the apocytochrome must be reduced. This reduction is coordinated by CcmH working in concert with CcmG and CcdA (or DsbD) .

  • A previously proposed quinone-binding site on CcmF has been investigated through mutagenesis studies, but research has shown that this site is not essential for cytochrome c maturation in either System I or System I* .

  • The CcmF/H complex must coordinate both the presentation of reduced apocytochrome and the delivery of heme from holo-CcmE, suggesting a complex interaction network among these components.

What are the implications of archaeal systems lacking CcmH for understanding cytochrome c biogenesis evolution?

The discovery that most, if not all, archaeal genomes sequenced thus far lack several ccm genes, including ccmH, ccmD, and ccmI, has important implications for understanding the evolution of cytochrome c biogenesis systems :

  • This suggests that Archaea use different mechanisms for cytochrome c biogenesis compared to the well-characterized bacterial Systems I and II.

  • The absence of CcmH in archaeal systems indicates that alternative proteins may perform the thiol-disulfide oxidoreductase functions necessary for preparing apocytochromes for heme attachment.

  • This evolutionary divergence provides an opportunity to identify novel mechanisms for cytochrome c biogenesis that may have arisen independently in the archaeal domain.

  • Comparative genomic and biochemical studies between bacterial and archaeal systems could reveal fundamental principles underlying the evolution of protein cofactor attachment systems.

  • Understanding these alternative systems could potentially inform biotechnological applications for engineering cytochrome c production in heterologous hosts.

How can recombinant CcmH be utilized in bioengineering applications?

Recombinant CcmH has potential applications in several bioengineering contexts:

  • Heterologous Cytochrome c Production:

    • Recombinant expression of CcmH as part of complete System I in hosts that naturally lack this system could enhance the production of various c-type cytochromes for biotechnological applications .

  • Synthetic Biology:

    • Engineering modified versions of CcmH with altered substrate specificity could potentially allow for the production of novel cytochromes with non-natural heme attachment sites.

  • Biocatalyst Development:

    • Cytochromes c produced using engineered maturation systems incorporating modified CcmH could serve as biocatalysts for various redox reactions.

  • Bioenergetic Systems:

    • Engineered CcmH could contribute to the development of improved microbial fuel cells by enhancing electron transfer capabilities.

What research challenges remain in understanding CcmH structure-function relationships?

Despite significant progress, several challenges remain in fully understanding CcmH:

  • High-Resolution Structural Data:

    • While the structure of related proteins like CcmG has been determined , high-resolution structural data for P. aeruginosa CcmH is still limited.

  • Dynamic Protein Interactions:

    • The transient nature of the interactions between CcmH and its partners (CcmF, CcmG, apocytochrome) makes them challenging to capture and characterize.

  • Complete Mechanistic Understanding:

    • The precise sequence of molecular events during the final step of cytochrome c maturation, particularly how the CcmF/H complex coordinates heme delivery and attachment, remains incompletely understood.

  • System-Specific Variations:

    • Differences in CcmH function and properties across bacterial species complicate the development of a unified model for its role in cytochrome c maturation.

  • Structural Basis of Substrate Recognition:

    • How CcmH recognizes and interacts with various apocytochromes with different sequence contexts surrounding the CXXCH motif remains to be fully elucidated. Understanding these aspects will require continued application of advanced structural biology techniques, protein interaction studies, and functional assays in various experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.