Recombinant Pseudomonas aeruginosa Cytochrome c-type biogenesis protein CycH (cycH)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pseudomonas aeruginosa Cytochrome c-type biogenesis protein CycH (cycH)

Pseudomonas aeruginosa is a Gram-negative bacterium known for its antibiotic resistance and association with hospital-acquired infections . Cytochrome c-type biogenesis protein CycH (cycH), is a protein crucial for the production of cytochrome c, a molecule involved in electron transport . CycH is found in both pathogenic and nonpathogenic strains of Pseudomonas aeruginosa .

Characteristics of CycH

CycH, also known as PA1483, is a cytochrome c-type biogenesis protein . It has a molecular weight of 43.3 kDa and an isoelectric point (pI) of 4.82 . The protein has a negative charge of -8.50 at pH 7 and a Kyte-Doolittle hydrophobicity value of -0.073, indicating it is relatively hydrophilic .

Table summarizing CycH characteristics

CharacteristicValue
Locus TagPA1483
Molecular Weight (kDa)43.3
Isoelectric Point (pI)4.82
Charge (pH 7)-8.50
Kyte-Doolittle Hydrophobicity Value-0.073

Function and Role

CycH is involved in cytochrome c biogenesis, a process necessary for energy production and cellular respiration . Cytochromes c facilitate electron transfer and participate in oxidation reactions .

Importance in Pseudomonas aeruginosa

  • Outer Membrane Protein: CycH is associated with the outer membrane of Pseudomonas aeruginosa, which contributes to the bacterium's ability to resist environmental stressors and interact with host cells during infection .

  • Biofilm Formation: Pseudomonas aeruginosa is known for forming biofilms, which can lead to chronic infections . Investigating proteins like CycH may offer insights into disrupting bacterial biofilm formation and enhancing antibiotic susceptibility .

  • Vaccine Development: Recombinant proteins like FtsZ and rOpmH have shown promise as protective antigens in Pseudomonas aeruginosa vaccine development . Immunization with FtsZ, for example, significantly reduced bacterial burden in the lungs and dissemination to the spleen in mice .

Recombinant CycH

Recombinant CycH is produced using genetic engineering techniques, often in E. coli or other expression systems . The recombinant form of the protein is valuable for research purposes, including:

  • Structural Studies: To understand the protein's structure and function .

  • Drug Discovery: As a target for developing new antimicrobial agents .

  • Vaccine Development: As a potential vaccine candidate .

Research and Detection

CycH has been detected using various proteomic techniques, including:

  • LC-MS/MS: Liquid chromatography with tandem mass spectrometry .

  • Nanoflow HPLC: Nanoflow high-pressure liquid chromatography in conjunction with microelectrospray ionization on LTQ XL mass spectrometer .

Genetic Information

The gene encoding CycH is located on the chromosome of Pseudomonas aeruginosa PAO1 between 1608068 and 1609291 base pairs . The protein is encoded by the gene PA1483 .

Potential Applications

Understanding the function and structure of CycH may lead to new strategies for combating Pseudomonas aeruginosa infections . Potential applications include:

  • Development of novel antimicrobials: Targeting CycH to disrupt cytochrome c biogenesis .

  • Enhancing antibiotic susceptibility: By interfering with the bacterium's resistance mechanisms .

  • Disrupting biofilm formation: Preventing chronic infections .

  • Vaccine development: Using CycH as a protective antigen .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
cycH; PA1483; Cytochrome c-type biogenesis protein CycH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
cycH
Target Protein Sequence
MIDFWLAAGLLLLAALAFLLIPLLRGRRAQAEEDRTALNVALYQERIAELAGQQAAGTLT AEQLENGRAEAARELLADTEGSGEERSSRLGRAVPLVAALLVPLVALGLYLHWGASDKVE LAREFAQAPHSMEEMTARLERAVQAQPDSAQGWYFLGRTYMTQERGADAARAFERAAELS GRQPEVLGQWAQALYFSGGKKMTAQIKALADEALKGDPAEVTTLGLLGIAAFEEQRYADA IGFWERLVSVLPNEDPARSAIQGGIQRARERMTEAGQTPPAPAAPAAAGVTLTVKVDISD AVKGQVKADDSVFVFARAVGGPPMPLAVKRLTVADLPAEVSLSDADAMMPQLKLSGFPQV ELVARVSRAGNAISGEWIGRGKPLSTAQSSAQALTIDGPDQPQAARP
Uniprot No.

Target Background

Function
Essential for c-type cytochrome biogenesis; potentially a subunit of a heme lyase.
Database Links

KEGG: pae:PA1483

STRING: 208964.PA1483

Protein Families
CycH family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Periplasmic side.

Q&A

What is the structural and functional role of Cytochrome c-type biogenesis protein CycH in Pseudomonas aeruginosa?

Cytochrome c-type biogenesis protein CycH (cycH) is a critical component of the cytochrome c maturation (ccm) operon in Pseudomonas aeruginosa. The protein functions within a complex system responsible for the proper assembly and maturation of c-type cytochromes. CycH (also annotated as CcmH in some organisms) likely works alongside other Ccm proteins, particularly CcmF, to facilitate the covalent attachment of heme to apocytochrome c. The protein contains conserved motifs involved in thiol-disulfide exchange necessary for the reduction of the apocytochrome c heme binding site prior to heme attachment . Within the functional context of Pseudomonas species, proper cytochrome c maturation is essential for various cellular processes, including respiratory chain function and, notably in related Pseudomonas strains, manganese oxidation .

How does CycH interact with other components of the cytochrome c maturation pathway?

CycH functions within the broader cytochrome c maturation (ccm) system that includes multiple proteins working in concert. Based on research with related Pseudomonas species, the Ccm system typically involves:

  • CcmA, CcmB, and CcmC, which form an ABC transporter complex likely responsible for heme translocation across the plasma membrane

  • CcmE, which may function as a heme chaperone

  • CcmF, which potentially functions as a transport protein for heme

  • CcmG, containing a CXXC motif typical of the thioredoxin-protein disulfide isomerase family

  • CcmH (CycH), which contains functional domains that suggest interaction with CcmG for the reduction of the apocytochrome c heme binding site

The sequential operation of these proteins ensures proper cytochrome c assembly, with CycH playing a critical role in the later stages of the process. Experimental evidence from related Pseudomonas strains shows that mutations in any component of this system, including CcmF (which operates closely with CycH), abolish cytochrome c production and associated functions .

What are the optimal storage conditions for recombinant Pseudomonas aeruginosa CycH protein to maintain its activity?

For optimal maintenance of recombinant Pseudomonas aeruginosa CycH protein activity, adhere to the following storage protocols:

FormRecommended StorageShelf Life
Liquid-20°C to -80°C6 months
Lyophilized-20°C to -80°C12 months

It is crucial to avoid repeated freeze-thaw cycles as they significantly compromise protein integrity. For working solutions, store aliquots at 4°C for no longer than one week . When preparing the protein for long-term storage, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by addition of glycerol to a final concentration of 5-50% (with 50% being standard practice) . This glycerol addition provides cryoprotection during freezing, helping to maintain the tertiary structure of the protein.

What reconstitution methods are recommended for lyophilized recombinant CycH protein prior to experimental use?

When working with lyophilized recombinant CycH protein, the following reconstitution protocol is recommended for optimal experimental results:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container

  • Reconstitute the protein in deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL

  • For long-term storage applications, add glycerol to a final concentration of 5-50% (with 50% being standard practice)

  • Create multiple small-volume working aliquots to minimize freeze-thaw cycles

This methodological approach ensures protein stability while maintaining functional integrity for downstream applications. The addition of glycerol serves as a cryoprotectant to preserve protein structure during freezing. When preparing multiple aliquots, ensure sterile handling techniques to prevent contamination that could compromise experimental results.

How can recombinant CycH be used to study cytochrome c maturation pathways in Pseudomonas aeruginosa?

Recombinant CycH provides a valuable tool for investigating cytochrome c maturation pathways in Pseudomonas aeruginosa through several methodological approaches:

  • Complementation studies: Purified recombinant CycH can be used to complement CycH mutants to confirm its role in restoring cytochrome c production. Research with related Pseudomonas species has demonstrated that genomic fragments containing the complete ccmF gene and partial ccmH gene successfully restore cytochrome c production in ccm mutants .

  • Protein-protein interaction assays: Utilizing techniques such as co-immunoprecipitation or pull-down assays with recombinant CycH can identify binding partners within the cytochrome c maturation system. This approach can validate predicted interactions with CcmF, CcmG and apocytochromes.

  • Site-directed mutagenesis: Systematic modification of conserved residues in recombinant CycH followed by functional assays can identify critical amino acids required for heme attachment and cytochrome c maturation.

  • In vitro reconstitution assays: Combining purified components of the Ccm system, including recombinant CycH, with apocytochrome c and heme precursors can help elucidate the sequential mechanisms of cytochrome assembly.

Research findings from related systems indicate that proper cytochrome c maturation is essential for numerous cellular functions, including manganese oxidation in Pseudomonas putida . Spectroscopic analysis of wild-type and Ccm-mutant strains reveals that disruption of the Ccm system, particularly through mutations in ccmF which operates closely with CycH, eliminates c-type cytochromes and associated cytochrome oxidase activity .

What experimental approaches are effective for studying the interaction between CycH and other proteins in the cytochrome c maturation pathway?

To effectively study interactions between CycH and other proteins in the cytochrome c maturation pathway, researchers can employ several methodological approaches:

TechniqueApplicationAdvantages
Co-immunoprecipitationIn vivo protein complex identificationCaptures physiologically relevant interactions
Biolayer interferometryReal-time binding kineticsProvides association/dissociation constants
Bacterial two-hybrid assaysProtein-protein interaction screeningSuitable for membrane proteins like Ccm components
Crosslinking mass spectrometryIdentification of interaction interfacesProvides structural insights into complexes
Förster resonance energy transfer (FRET)Dynamic interactions in living cellsReveals spatial and temporal aspects of interactions

When designing such experiments, it's essential to consider the membrane-associated nature of many Ccm proteins. Research on related systems has established that CcmF likely functions as a transport protein, possibly for heme, while CcmH (CycH) contains motifs typical of thioredoxin-disulfide isomerases that may interact with CcmG . These interactions form part of a complex system where CcmA, CcmB, and CcmC constitute an ABC transporter potentially involved in heme translocation, while CcmE, CcmF, CcmH, and CcmI are proposed to form a cytochrome c heme lyase complex for covalent attachment of heme to apocytochrome c .

How does CycH function contribute to Pseudomonas aeruginosa virulence and pathogenicity in host infections?

The contribution of CycH to Pseudomonas aeruginosa virulence stems from its essential role in cytochrome c maturation, which impacts several pathogenicity mechanisms:

  • Respiratory flexibility: Functional cytochromes are critical for P. aeruginosa's ability to thrive in diverse host environments, particularly the oxygen-limited conditions of biofilms and the cystic fibrosis (CF) lung. By ensuring proper cytochrome c maturation, CycH enables the pathogen's metabolic adaptability during infection .

  • Biofilm formation: Proper cytochrome function supports the complex metabolic networks required for biofilm development. P. aeruginosa strains with cytochrome c maturation defects may show reduced biofilm formation capacity, a key virulence trait particularly important in CF lung infections where 45.3% of patients are colonized with P. aeruginosa .

  • Survival in inflammatory environments: During host infection, P. aeruginosa encounters various stress conditions, including oxidative stress from neutrophil respiratory burst. Properly matured cytochromes contribute to stress response mechanisms, with research showing that neutropenic mice require a 100,000-fold lower infectious dose compared to mice with normal neutrophil levels .

  • Adaptation to chronic infection: The genetic diversity and recombination frequency of P. aeruginosa (with studies identifying 274 different sequence types among 501 isolates) facilitate its adaptation to chronic infection scenarios . The cytochrome maturation system, including CycH, supports this adaptation by maintaining energy metabolism in changing host environments.

Research indicates that most CF strains of P. aeruginosa represent a random sample of the broader environmental population, with increased abundance of specific strains likely resulting from chance colonization events followed by adaptation to the CF lung and patient-to-patient transmission .

How does CycH expression vary across different Pseudomonas aeruginosa strains isolated from clinical versus environmental sources?

Analysis of CycH expression patterns across clinical and environmental Pseudomonas aeruginosa isolates reveals important insights into strain variation and adaptive mechanisms:

The genetic diversity of P. aeruginosa is extensive, with multilocus sequence typing (MLST) studies identifying 274 different sequence types among 501 isolates from various sources in South East Queensland, Australia . Of these sequence types, 53 were shared between one or more ecological settings, indicating limited association between genotype and environment . This genetic heterogeneity extends to the cytochrome c maturation system, including CycH.

Several patterns emerge when comparing CycH across clinical and environmental isolates:

  • Core conservation with peripheral variation: The functional domains of CycH tend to be highly conserved across strains, while peripheral regions may show greater sequence diversity reflecting adaptation to specific niches.

  • Expression regulation differences: Clinical isolates, particularly those from chronic infections, may show altered regulation of the ccm operon, potentially as part of adaptive responses to antibiotic pressure and host immune defense mechanisms.

  • Strain-specific functional adaptations: While some CF-specific strains were encountered in multiple ecological settings, the most frequently encountered CF strains were confined to CF patients . This suggests potential specialization of cytochrome systems, including CycH function, in persistent clinical strains.

The evidence for frequent recombination in P. aeruginosa populations indicates that genetic elements affecting CycH expression may be horizontally transferred between strains. This contributes to the non-clonal epidemic structure observed in P. aeruginosa populations and influences the functional variations in cytochrome c maturation systems across different ecological niches.

What methodologies can be used to assess the impact of CycH mutations on cytochrome c maturation and function?

To comprehensively assess the impact of CycH mutations on cytochrome c maturation and function, researchers can implement the following methodological approaches:

  • Spectroscopic analysis: Differential spectroscopy represents a primary method for evaluating c-type cytochrome levels. Studies with related Pseudomonas species demonstrated that ccmF mutants (which would affect the closely associated CycH function) showed absence of c-type cytochromes that were clearly present in wild-type strains . Specific absorption peaks at characteristic wavelengths (typically around 550 nm) can be measured to quantify functional cytochromes.

  • Cytochrome oxidase activity assays: Standard biochemical assays measuring cytochrome oxidase activity provide functional assessment of the cytochrome c maturation pathway. Research has established that mutations affecting the ccm system resulted in cytochrome oxidase-negative phenotypes .

  • Complementation analysis: Introducing wild-type or variant CycH on expression vectors into CycH-deficient strains can determine whether specific mutations affect protein function. Quantitative restoration of cytochrome levels correlates with the functionality of the introduced variant.

  • Protein-protein interaction changes: Using techniques such as bacterial two-hybrid systems or co-immunoprecipitation to assess how mutations affect CycH interactions with other Ccm proteins (particularly CcmF and CcmG).

  • Phenotypic assays for downstream functions: In related Pseudomonas species, ccm mutations abolished manganese oxidation capabilities . Similar phenotypic assays relevant to P. aeruginosa can include:

Functional AssayMeasurementRelevance to CycH Function
Respiration ratesOxygen consumptionReflects electron transport chain function
Biofilm formationCrystal violet stainingIndicates metabolic integration in complex communities
Survival under oxidative stressGrowth in presence of H₂O₂Measures impact on stress response mechanisms
Virulence factor productionEnzymatic/reporter assaysAssesses broader metabolic consequences

These approaches provide comprehensive assessment of both direct (cytochrome c levels) and indirect (downstream metabolic consequences) effects of CycH mutations on bacterial physiology.

How can researchers design experiments to investigate potential post-translational modifications of CycH and their functional implications?

Designing robust experiments to investigate post-translational modifications (PTMs) of CycH requires a systematic approach that combines identification, site mapping, and functional characterization:

Identification and Mapping Methodology:

  • Mass spectrometry-based proteomics: Employ high-resolution LC-MS/MS analysis of purified recombinant CycH to identify potential PTMs. Combining bottom-up (peptide level) and top-down (intact protein) MS approaches provides comprehensive coverage. For membrane-associated proteins like CycH, specialized extraction protocols using compatible detergents are essential.

  • Site-directed mutagenesis: Based on MS identification, create point mutations at putative modification sites (e.g., converting potentially phosphorylated serine/threonine residues to alanine) to confirm their importance for function.

  • Modification-specific antibodies: Develop antibodies against specific predicted PTMs to enable western blotting detection of modification states.

Functional Characterization Workflow:

  • Comparative activity assays: Compare the activity of differentially modified forms of CycH in cytochrome c maturation using in vitro reconstitution systems.

  • Protein structure analysis: Use techniques like hydrogen-deuterium exchange MS (HDX-MS) or limited proteolysis to determine how PTMs affect protein conformation.

  • Protein-protein interaction changes: Assess how PTMs impact interactions with other Ccm components using techniques such as surface plasmon resonance or pull-down assays coupled with quantitative MS.

  • In vivo modification patterns: Analyze how environmental conditions relevant to P. aeruginosa pathogenesis (iron limitation, oxidative stress, biofilm growth) affect CycH modification patterns.

Given that cytochrome c maturation involves redox chemistry and potential thiol-disulfide exchange reactions, particular attention should be paid to oxidative modifications of cysteine residues in CycH. The CcmG and CcmH proteins typically contain CXXC motifs characteristic of thioredoxin-protein disulfide isomerase family members , suggesting that redox-based PTMs may be functionally significant in this system.

What are common challenges in expressing and purifying recombinant CycH, and how can researchers address them?

Researchers frequently encounter several obstacles when expressing and purifying recombinant CycH. The following table outlines these challenges along with evidence-based solutions:

ChallengeUnderlying CauseSolution Strategy
Low expression yieldMembrane association/toxicityUse specialized expression systems (C41/C43 E. coli strains); consider mammalian cell expression systems which have shown success with CycH
Protein insolubilityHydrophobic domainsOptimize detergent selection; screen detergents like DDM, LDAO, and Fos-choline-12 for extraction efficiency
Protein misfoldingIncorrect disulfide formationExpress in the presence of thioredoxin/chaperones; include reducing agents during purification
Aggregation during purificationHydrophobic interactionsInclude stabilizing agents (glycerol 5-10%); maintain detergent above CMC throughout purification
Loss of activityCofactor dissociationEnsure proper reconstitution protocols; add relevant cofactors during final dialysis
Proteolytic degradationExposed cleavage sitesAdd protease inhibitors; minimize purification time; maintain samples at 4°C

For optimal results when working with recombinant CycH, implementing a mammalian cell expression system has proven effective, yielding protein with >85% purity as assessed by SDS-PAGE . After purification, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to 5-50% final concentration, helps maintain protein stability .

When troubleshooting expression issues, consider that the protein's specific properties as part of the cytochrome c maturation system may require specialized handling. Evidence from related systems indicates that CycH functions in concert with other membrane-associated proteins of the Ccm system , suggesting that co-expression with interaction partners might improve stability and solubility.

How can researchers effectively design controls for experiments involving recombinant CycH to ensure valid interpretation of results?

Designing robust controls for experiments involving recombinant CycH requires careful consideration of both positive and negative controls across multiple dimensions:

Protein Quality Controls:

  • Purity verification: Beyond standard SDS-PAGE analysis (targeting >85% purity) , include size exclusion chromatography to confirm monodispersity and absence of aggregates.

  • Functional confirmation: Establish a reliable activity assay before experimental use. For CycH, this might involve measuring its ability to complement ccm mutants or reconstitute cytochrome c maturation in vitro.

  • Thermal stability assessment: Use differential scanning fluorimetry to verify that the recombinant protein exhibits expected stability profiles, confirming proper folding.

Experimental Controls:

  • Negative protein controls: Include:

    • Heat-inactivated CycH (demonstrating that activity requires properly folded protein)

    • Site-directed mutants targeting conserved functional residues (establishing structure-function relationships)

    • Unrelated proteins of similar size/charge (ruling out non-specific effects)

  • System-specific controls: When studying cytochrome c maturation:

    • Include bacterial strains with defined mutations in ccm genes to serve as reference points

    • Compare spectroscopic signatures with known profiles of strains with and without functional cytochrome c systems

  • Complementation controls: When using CycH to restore function in mutant strains:

    • Include the empty vector control

    • Use partial constructs missing key domains

    • Compare with positive control using genomic fragments containing the complete gene

  • Interaction controls: For protein-protein interaction studies:

    • Include proteins known not to interact with the Ccm system

    • Use truncated versions of CycH lacking key interaction domains

    • Compare with established interaction pairs from the Ccm system

Research with related systems has demonstrated that complementation with genomic fragments containing ccm genes successfully restores cytochrome c production and associated functions, such as manganese oxidation, in ccm mutants . These established complementation approaches provide valuable reference points for experimental design with recombinant CycH.

How might structural biology approaches advance our understanding of CycH function in the cytochrome c maturation system?

Advanced structural biology techniques offer significant potential to resolve critical questions about CycH function within the cytochrome c maturation system:

  • Cryo-electron microscopy (cryo-EM): This technique could resolve the membrane-associated complexes formed between CycH and other Ccm proteins, particularly CcmF with which it likely forms functional assemblies. Cryo-EM is particularly valuable for the Ccm system as it can capture the native membrane environment and potentially reveal conformational changes during the heme attachment process.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography of soluble domains, NMR for dynamic regions, and crosslinking mass spectrometry) would provide complementary insights into CycH structure and interactions. This approach could map the interaction interfaces between CycH and partners like CcmF, CcmG, and apocytochrome c substrates.

  • Time-resolved structural methods: These techniques could capture the transient states during cytochrome c maturation, potentially revealing how CycH participates in the coordinated process of heme attachment. Research has established that CcmF and CcmH (CycH) likely function as subunits of a cytochrome c heme lyase involved in the covalent attachment of heme to apocytochrome c .

  • Molecular dynamics simulations: Based on experimental structures, computational approaches could model the dynamics of CycH interactions with other components and predict conformational changes during function.

Structural insights would address several outstanding questions about the Ccm system, including:

  • The precise mechanism by which CycH contributes to apocytochrome c reduction prior to heme attachment

  • How the proposed ABC transporter components (CcmA, CcmB, CcmC) coordinate with the putative heme lyase complex (CcmE, CcmF, CcmH/CycH, CcmI)

  • The structural basis for CycH specificity toward particular cytochrome c substrates

These approaches would significantly advance our understanding beyond the current knowledge that mutations in ccmF (which works closely with CycH) abolish cytochrome c production and associated functions in Pseudomonas species .

What are the implications of recent genetic diversity findings in Pseudomonas aeruginosa for research on cytochrome c maturation systems?

Recent findings regarding the extensive genetic diversity of Pseudomonas aeruginosa have profound implications for research on cytochrome c maturation systems, including CycH:

Multilocus sequence typing (MLST) studies have revealed remarkable genetic heterogeneity in P. aeruginosa populations, with 274 different sequence types identified among 501 isolates from environmental, animal, and human sources . This genetic diversity, coupled with evidence of frequent recombination and limited association between genotype and environment , suggests several important considerations for CycH research:

  • Functional conservation amid sequence variation: The essential role of the cytochrome c maturation system likely imposes selective pressure maintaining core functional domains of CycH, even as peripheral regions may vary. Researchers should focus on identifying these conserved functional elements across diverse strains.

  • Strain selection considerations: The finding that genetic diversity of P. aeruginosa in Queensland, Australia was indistinguishable from the global P. aeruginosa population suggests that researchers must carefully consider strain selection to represent this diversity in experimental systems.

  • Adaptation to specific niches: While most CF strains represent a random sample of the broader P. aeruginosa population, some CF strains show increased abundance in different geographical regions . This pattern of adaptation to specific environments (like the CF lung) may involve modifications to energy metabolism systems, potentially including cytochrome c maturation.

  • Horizontal gene transfer implications: The evidence for frequent recombination suggests that elements of the ccm operon might be horizontally transferred between strains. This possibility necessitates examination of the genomic context of cycH across diverse isolates.

  • Diagnostic and therapeutic targeting: The non-clonal epidemic structure confirmed by population studies suggests that targeting highly conserved elements of essential systems like cytochrome c maturation might provide broadly effective intervention strategies against diverse P. aeruginosa strains.

These findings necessitate a comparative approach to CycH research, examining functional conservation and variation across the diverse P. aeruginosa population to identify universally critical features of the cytochrome c maturation system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.