Recombinant Pseudomonas aeruginosa Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly state your preference when placing the order, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquot the protein to minimize repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyoD; PA1320; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
cyoD
Target Protein Sequence
MSSAAHDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGFSRHATILTMVVLGLVQVV VHLICFLHMNMSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is the predominant component of the aerobic respiratory chain in *E. coli* when grown under high aeration conditions. It exhibits both electron transfer and proton pump activity across the membrane, transporting 2 protons per electron.
Database Links

KEGG: pae:PA1320

STRING: 208964.PA1320

Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa Cytochrome o ubiquinol oxidase protein CyoD?

CyoD is one of the subunits of the cytochrome o ubiquinol oxidase complex in Pseudomonas aeruginosa. This complex functions as a terminal catalyst in the bacterial respiratory chain, catalyzing the reduction of molecular oxygen to water while generating a transmembrane proton gradient. The cytochrome o complex is encoded by the cyo operon, which consists of five open reading frames: cyoA, cyoB, cyoC, cyoD, and cyoE . As part of this haem-copper oxidase superfamily, the complex plays a crucial role in aerobic energy metabolism in P. aeruginosa, similar to its homolog in Escherichia coli .

What are effective expression systems for recombinant P. aeruginosa CyoD?

Expression of membrane proteins like CyoD presents significant challenges. E. coli is commonly used as an expression host, but standard strains often struggle with membrane protein production due to cellular stress responses (CSR) triggered by recombinant protein synthesis . Recent research has demonstrated that engineered strains with specific gene knockouts can significantly improve expression yields. The double knockout E. coli strain BW25113 ΔelaAΔcysW has shown enhanced capability for expressing difficult or toxic proteins by preventing the typical down-regulation of critical cellular processes that occurs during CSR . For optimal expression of CyoD specifically, this system could be further optimized by supplementing the expression of substrate uptake genes that remain down-regulated even in the knockout strain.

What transcriptional changes occur during recombinant CyoD expression?

Transcriptome analysis of engineered expression strains reveals that during standard recombinant protein expression, numerous genes are down-regulated as part of the cellular stress response, including those involved in transcription, translation, protein folding, ribosome biogenesis, and energy metabolism . Interestingly, in the ΔelaAΔcysW double knockout strain, a significantly smaller proportion of genes were down-regulated post-induction. Specific to the cytochrome o complex, the double knockout strain showed a much lower down-regulation of cyoABCE genes (1.1-1.8-fold) and an up-regulation of cyoD (1.45-fold) . This differential regulation of cyoD compared to other components of the same operon suggests unique regulatory mechanisms that could be leveraged for improved expression.

What techniques are most effective for structural characterization of CyoD?

Structural analysis of membrane proteins like CyoD requires specialized approaches. Current methodologies used for similar proteins include:

TechniqueResolutionSample RequirementsAdvantagesLimitations
X-ray CrystallographyAtomic (≤3Å)Highly purified, stable crystalsAtomic-level detailsDifficult crystallization
Cryo-Electron Microscopy3-6ÅPurified protein in detergent or lipidNo crystallization neededSample preparation challenges
Molecular DynamicsDepends on starting modelComputational resourcesCan model dynamicsAccuracy depends on force fields
NMR SpectroscopyAtomic for small proteinsIsotope-labeled samplesSolution structureSize limitations

Cryo-electron microscopy has been successfully applied to the E. coli cytochrome bo complex, achieving resolution beyond 5Å, with a projection map calculated to a resolution of 6Å. This technique allowed for the identification of all four subunits and resolution of individual α-helices within the protein complex . Similar approaches could be applied to study the P. aeruginosa cytochrome o complex containing CyoD.

How can researchers distinguish CyoD from other subunits in structural studies?

Distinguishing CyoD from other subunits requires multiple complementary approaches. In previous studies of cytochrome oxidases, researchers have used:

  • Antibody labeling: Generating subunit-specific antibodies that can be visualized in electron microscopy

  • Expression of individual subunits: As demonstrated with cyoA and cyoB in E. coli, expressing cyoD independently can help characterize its specific properties

  • Comparative analysis: Studying complexes with and without specific subunits to identify structural differences

  • Mass spectrometry: Identifying protein-protein crosslinks to map the spatial arrangement of subunits

Studies with E. coli have demonstrated that polyclonal antibodies can effectively identify specific subunits of the purified oxidase, confirming their correspondence to genes in the cyo operon .

How can researchers assess the functionality of recombinant CyoD in the cytochrome o complex?

Assessing functionality requires examining both the incorporation of CyoD into the complex and the activity of the assembled complex. Key methodologies include:

  • Spectroscopic analysis: The cytochrome o complex contains heme groups with characteristic absorption spectra. Reduced-minus-oxidized spectra can reveal the presence of specific heme components (b555 and b562)

  • CO binding assays: As shown in E. coli studies, the heme component binds to CO, which can be detected spectroscopically

  • Enzyme activity assays: Measuring ubiquinol oxidase activity through oxygen consumption rates

  • Proton pumping assays: Evaluating the complex's ability to generate a proton gradient

When expressing recombinant proteins, it's important to verify that the proteins are stably inserted into the membrane, as has been demonstrated with cyoA and cyoB expression in E. coli .

What is known about the regulation of cyoD expression in response to environmental conditions?

  • During cellular stress response (CSR) in wild-type E. coli, genes of the cyo operon are significantly down-regulated

  • In engineered strains (ΔelaAΔcysW), cyoABCE genes show reduced down-regulation (1.1-1.8-fold) while cyoD shows up-regulation (1.45-fold)

  • Other energy metabolism genes, including those encoding ATP synthase (atp operon) and NADH-quinone oxidoreductase (nuoA), show minimal changes in transcript levels in the double knockout strain compared to severe down-regulation in control strains

This differential regulation suggests that cyoD may play a unique role under stress conditions, potentially as part of an adaptive response to maintain respiratory function.

What is the relationship between cytochrome o oxidase and other virulence systems in P. aeruginosa?

P. aeruginosa employs multiple virulence mechanisms, with complex regulatory networks controlling their expression. Research has identified connections between energy metabolism and virulence regulation:

  • The Type III Secretion System (T3SS) is an important virulence factor that contributes to P. aeruginosa acute infection

  • Regulatory systems like CysB (a LysR family transcriptional regulator) influence both T3SS expression and swarming motility

  • Mutations affecting regulatory pathways can shift bacteria between acute infection phenotypes (high T3SS, high motility) and chronic infection phenotypes (biofilm formation)

While direct studies linking cyoD to these virulence mechanisms are not available in the provided search results, the integral role of energy metabolism in bacterial pathogenesis suggests potential connections worthy of investigation.

What are common challenges in expressing recombinant membrane proteins like CyoD?

Membrane proteins present numerous experimental challenges:

ChallengeDescriptionSolution Strategies
Low expression yieldsToxicity to host cells due to membrane protein overexpressionUse engineered strains that prevent CSR activation; optimize induction conditions
Protein misfoldingDifficulty achieving native conformation in heterologous systemsCo-express with chaperones; use lower temperatures; optimize growth media
Aggregation during purificationLoss of structural integrity during extractionScreen detergents; maintain critical lipid interactions; optimize buffer conditions
Functional assessmentDifficulty measuring activity of individual subunitsExpress with partner proteins; reconstitute in artificial membranes
Cellular stress responseDown-regulation of host cell machineryUse double knockout strains like ΔelaAΔcysW that prevent CSR effects

Recent research has demonstrated that the cellular stress response is a major limitation in recombinant protein expression. By preventing this response through strategic gene knockouts, researchers have achieved 2.5-fold enhancement in expression of difficult-to-express proteins .

How can researchers overcome the cellular stress response during CyoD expression?

A innovative approach to enhance recombinant protein expression involves preventing the cellular stress response that normally limits protein yields:

  • Use of double knockout strains (e.g., ΔelaAΔcysW) that block CSR signaling pathways

  • Supplementation with expression of specific genes that remain down-regulated even in knockout strains (particularly substrate uptake genes)

  • Fine-tuning of expression conditions to minimize stress triggers

  • Co-expression of partner proteins that may stabilize CyoD

Transcriptomic analysis has shown that the double knockout approach prevents down-regulation of critical pathways including transcription, translation, protein folding, ribosome biogenesis, and energy metabolism, effectively addressing the major limitations in recombinant protein expression .

How does P. aeruginosa cytochrome o oxidase compare to similar complexes in other bacteria?

Cytochrome oxidases are found across diverse bacterial species, with structural and functional variations:

  • E. coli cytochrome bo: Well-characterized with crystal structures and functional studies; consists of four subunits and contains two heme b prosthetic groups (b555 and b562) plus copper

  • Mitochondrial cytochrome c oxidase: Evolutionary related but uses cytochrome c rather than ubiquinol as electron donor

  • P. aeruginosa cytochrome o: Similar core structure to E. coli homolog but with potential species-specific adaptations

Structural studies of E. coli cytochrome bo using cryo-electron microscopy have revealed that all four subunits can be identified and single α-helices resolved within the protein complex . Comparison with cytochrome c oxidase shows clear structural similarity within the common functional core surrounding the metal-binding sites in subunit I, while also revealing subtle differences due to distinct subunit composition .

What insights from E. coli cytochrome bo studies can be applied to P. aeruginosa CyoD?

Studies of E. coli cytochrome bo provide valuable insights applicable to P. aeruginosa CyoD:

  • Expression studies demonstrate that individual subunits like CyoA and CyoB can be stably inserted into the membrane when expressed independently

  • Subunit I (CyoB) alone is sufficient for assembly of the stable CO-binding heme component

  • Cryo-electron microscopy techniques that successfully resolved the E. coli complex structure can likely be applied to P. aeruginosa

  • Structural comparison between ubiquinol oxidases and cytochrome c oxidases reveals conservation of core functional elements while highlighting adaptations for different electron donors

These insights suggest strategies for expressing and studying P. aeruginosa CyoD, either independently or as part of the complete cytochrome o complex.

What are promising areas for future research on P. aeruginosa CyoD?

Several compelling research directions emerge from current knowledge:

  • High-resolution structural studies of P. aeruginosa cytochrome o complex using advanced cryo-EM techniques

  • Investigation of the differential regulation of cyoD compared to other cyo operon genes during stress conditions

  • Exploration of the potential role of CyoD in adaptation to different oxygen tensions within host environments

  • Development of inhibitors targeting cytochrome o oxidase as potential antimicrobial agents

  • Engineering of expression systems that specifically enhance CyoD production without triggering cellular stress responses

The recent advances in preventing cellular stress responses during recombinant protein expression particularly open opportunities for improved structural and functional studies of challenging membrane proteins like CyoD.

How might advanced genetic engineering approaches improve CyoD expression and characterization?

Advanced genetic approaches offer promising avenues for enhanced study of CyoD:

  • CRISPR-Cas9 genome editing to create precisely tuned expression systems

  • Synthetic biology approaches to design optimized cyo operons with modified regulatory elements

  • Combination of multiple stress-response blocking mutations based on transcriptomic data

  • Development of reporter systems to monitor CyoD incorporation into the membrane and complex assembly

  • Creation of chimeric proteins that combine the structural stability of well-expressed homologs with the specific properties of P. aeruginosa CyoD

Recent work demonstrating that gene knockouts can block critical aspects of the cellular stress response suggests that further refinement of these approaches could yield even greater improvements in recombinant membrane protein expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.