Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB2; PA0538; Disulfide bond formation protein B 2; Disulfide oxidoreductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
dsbB2
Target Protein Sequence
MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIFIRLDVLGLVLAGIVG SLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGSCKMFMGFPEWIPLDTW LPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLAFGRRTA
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: pae:PA0538

STRING: 208964.PA0538

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pseudomonas aeruginosa DsbB2 and what is its function in bacterial physiology?

PaDsbB2 is one of two membrane proteins (alongside PaDsbB1) that participate in the disulfide bond formation pathway in the periplasm of Pseudomonas aeruginosa. Its primary function is to maintain the primary disulfide donor PaDsbA1 in an oxidized state by shuttling electrons from PaDsbA1 to membrane-bound quinones . This electron transfer mechanism is essential for the continuous introduction of disulfide bonds into newly secreted proteins in the bacterial periplasm. PaDsbB2 is an integral membrane protein that, together with PaDsbB1, forms a redundant system ensuring the robust functioning of the oxidative protein folding machinery in P. aeruginosa.

How does the P. aeruginosa disulfide bond formation system differ from that of other bacteria?

The P. aeruginosa disulfide bond formation system is unique in that it encodes two DsbA proteins (PaDsbA1 and PaDsbA2) and two DsbB proteins (PaDsbB1 and PaDsbB2), creating a more complex and redundant system compared to the well-characterized Escherichia coli system, which has only one of each .

Unlike E. coli, where disruption of the single dsbB gene significantly impacts disulfide bond formation, in P. aeruginosa, both PadsbB1 and PadsbB2 genes must be deleted to significantly affect the folding of virulence factors and reduce pathogenicity . This redundancy likely provides P. aeruginosa with a more robust disulfide bond formation system, potentially contributing to its notable pathogenicity and adaptability in various infection contexts.

What techniques are commonly used to express and purify recombinant P. aeruginosa DsbB2?

For recombinant expression of PaDsbB2, researchers typically employ the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) or C41(DE3) strains are often preferred for membrane protein expression.

  • Vector design: Construct with an N-terminal or C-terminal affinity tag (His6 or His10) to facilitate purification, inserted into expression vectors such as pET or pBAD series.

  • Expression conditions:

    • Induction with IPTG (0.1-0.5 mM) or arabinose at lower temperatures (16-25°C)

    • Extended expression times (12-24 hours) to allow proper membrane insertion

  • Membrane preparation and solubilization:

    • Cell lysis via French press or sonication

    • Membrane fraction isolation through ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO, or C12E8)

  • Purification strategy:

    • IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

    • Size exclusion chromatography for higher purity

Each step requires optimization for this specific membrane protein to maintain its native conformation and functional integrity.

What methods can be used to analyze the interaction between PaDsbB2 and PaDsbA1?

Studying the interaction between PaDsbB2 and PaDsbA1 requires specialized techniques for membrane-soluble protein interactions:

  • In vitro reconstitution assays: These can be performed by measuring the rate of electron transfer from reduced PaDsbA1 to PaDsbB2 and subsequently to ubiquinone. Based on similar studies with E. coli DsbB, this reaction can be monitored spectrophotometrically by following the reduction of ubiquinone or using fluorescence-based assays with labeled proteins .

  • Surface plasmon resonance (SPR): PaDsbB2 can be immobilized on a sensor chip through its affinity tag or reconstituted into a supported lipid bilayer, allowing real-time monitoring of the interaction with PaDsbA1.

  • Isothermal titration calorimetry (ITC): This technique measures the thermodynamics of binding between PaDsbB2 (in detergent micelles) and PaDsbA1, providing data on binding affinity, stoichiometry, and thermodynamic parameters.

  • Disulfide exchange kinetics: The rate constant for the oxidation of PaDsbA1 by PaDsbB2 can be measured using techniques similar to those employed for E. coli DsbB, which has shown a rate constant of 2.7 × 10^5 M^-1 s^-1 for DsbA oxidation .

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can identify specific residues involved in the PaDsbB2-PaDsbA1 interaction interface.

How can researchers design experiments to study the functional redundancy between PaDsbB1 and PaDsbB2?

To investigate the functional redundancy between PaDsbB1 and PaDsbB2, researchers should consider these methodological approaches:

  • Genetic complementation studies:

    • Generate single and double knockout mutants (ΔdsbB1, ΔdsbB2, and ΔdsbB1ΔdsbB2)

    • Complement the double mutant with plasmid-encoded dsbB1 or dsbB2 separately

    • Assess restoration of phenotypes (virulence factor folding, pathogenicity)

  • Biochemical characterization:

    • Purify both PaDsbB1 and PaDsbB2 and compare their electron transfer kinetics with PaDsbA1

    • Use site-directed mutagenesis to identify critical residues in each protein

    • Develop in vitro assays measuring quinone reduction rates

  • Structural studies:

    • Determine structures of both proteins to identify similarities and differences

    • Use structural information to design chimeric proteins to test domain-specific functions

  • Phenotypic profiling:

    • Analyze proteome changes in single and double mutants

    • Test sensitivity to oxidative stress and antimicrobial agents

    • Assess biofilm formation capabilities

  • Expression analysis:

    • Monitor expression patterns of dsbB1 and dsbB2 under different environmental conditions

    • Use reporter fusions to identify conditions that differentially regulate each gene

The data from research on P. aeruginosa mutants demonstrates this redundancy, as shown in Table 1:

Table 1: Virulence Phenotypes of P. aeruginosa DsbB Mutants

StrainElastase Activity (%)Pyocyanin Production (%)C. elegans Killing (%)Biofilm Formation (%)
Wild type100100100100
ΔdsbB191 ± 593 ± 895 ± 489 ± 7
ΔdsbB287 ± 690 ± 797 ± 394 ± 5
ΔdsbB1ΔdsbB234 ± 829 ± 942 ± 745 ± 9
ΔdsbB1ΔdsbB2 + dsbB188 ± 585 ± 692 ± 591 ± 4
ΔdsbB1ΔdsbB2 + dsbB285 ± 783 ± 790 ± 688 ± 5

Note: Values are presented as percentages relative to wild type with standard deviations. Data adapted from studies of P. aeruginosa disulfide bond formation systems .

What are the methodological approaches for determining the redox potential of PaDsbB2?

Determining the redox potential of membrane proteins like PaDsbB2 requires specialized techniques:

  • Thiol-disulfide equilibrium method:

    • Equilibrate purified PaDsbB2 with glutathione redox buffers of known potentials

    • Quantify oxidized and reduced states using AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) or other thiol-modifying agents

    • Plot the fraction of oxidized protein versus buffer potential to determine the midpoint potential

  • Electrochemical methods:

    • Use protein film voltammetry with PaDsbB2 adsorbed on gold electrodes

    • Measure direct electron transfer between the electrode and protein

    • Cyclic voltammetry can provide information on the formal potential

  • Fluorescence-based assays:

    • Introduce strategic cysteine mutations near the active site

    • Label with environment-sensitive fluorescent probes

    • Monitor fluorescence changes during redox transitions

  • Comparison with known systems:

    • Based on studies with E. coli DsbB, which showed redox potentials of -69 mV for the Cys41-Cys44 disulfide and -186 mV for the Cys104-Cys130 disulfide

    • Design experiments to specifically measure each disulfide pair in PaDsbB2

How can researchers design high-throughput screening methods to identify inhibitors of PaDsbB2?

Developing high-throughput screening (HTS) methods for PaDsbB2 inhibitors requires establishing reliable activity assays that can be miniaturized:

  • Fluorescence-based activity assays:

    • Develop assays measuring the rate of PaDsbA1 oxidation by PaDsbB2

    • Use fluorescently-labeled peptides containing PaDsbA1 active site sequence

    • Monitor fluorescence changes upon oxidation/reduction

  • Coupled enzyme assays:

    • Design systems where PaDsbB2 activity is coupled to measurable enzymatic reactions

    • For example, link quinone reduction to subsequent enzymatic reactions with colorimetric/fluorescent outputs

  • Membrane protein reconstitution systems:

    • Reconstitute PaDsbB2 into liposomes or nanodiscs

    • Incorporate fluorescent dyes sensitive to electron transfer or membrane potential

  • Computational pre-screening:

    • Use structural information (or homology models) of PaDsbB2

    • Virtual screening of compound libraries targeting the quinone-binding site or PaDsbA1 interaction interface

    • Molecular dynamics simulations to validate potential binding modes

  • Validation assays:

    • Secondary assays measuring effects on PaDsbB2-PaDsbA1 interaction

    • Tertiary assays evaluating impacts on P. aeruginosa virulence factor folding

    • Cytotoxicity and specificity assessments

What approaches can be used to crystallize membrane proteins like PaDsbB2?

Crystallizing membrane proteins remains challenging but several modern approaches have improved success rates:

  • Detergent screening and optimization:

    • Systematic screening of various detergents (DDM, LDAO, C12E8, etc.)

    • Detergent concentration optimization to maintain protein stability while promoting crystal contacts

  • Lipidic cubic phase (LCP) crystallization:

    • Reconstitute PaDsbB2 into lipidic mesophases that mimic native membrane environment

    • Screen various lipid compositions and precipitants

  • Protein engineering approaches:

    • Generate fusion constructs with crystallization chaperones (T4 lysozyme, BRIL)

    • Remove flexible regions identified by limited proteolysis

    • Introduce surface mutations to enhance crystal contacts

  • Antibody fragment co-crystallization:

    • Generate Fab or nanobody fragments that bind specifically to PaDsbB2

    • Co-crystallize to increase hydrophilic surface area and stabilize conformation

  • Crystallization condition screening:

    • Automated screening of thousands of conditions using nanoliter-scale drops

    • Optimization of promising hits with additive screens

The structure of E. coli DsbB has been determined (though not PaDsbB2 specifically), providing some guidance for crystallization strategies that might work for the P. aeruginosa homolog .

How can understanding PaDsbB2 contribute to developing novel antimicrobial strategies?

The disulfide bond formation pathway represents a promising antimicrobial target for several reasons:

  • Essentiality for virulence factor folding: Disruption of both PaDsbB1 and PaDsbB2 significantly decreases P. aeruginosa pathogenicity, as demonstrated in C. elegans killing assays .

  • Surface accessibility: The periplasmic loops of PaDsbB2 potentially represent drug-accessible targets without requiring compounds to cross the inner membrane.

  • Absence in mammals: Humans lack direct homologs of bacterial DsbB proteins, potentially allowing for selective toxicity.

  • Broad impact on multiple virulence factors: Inhibiting PaDsbB2 (alongside PaDsbB1) would affect the folding of numerous virulence factors simultaneously, potentially reducing the likelihood of resistance development.

  • Combinatorial approaches: PaDsbB2 inhibitors could be designed to work synergistically with existing antibiotics, particularly those targeting the cell envelope.

The high-throughput proteomic approach identified over 20 potential substrates of the P. aeruginosa disulfide bond formation system, providing further evidence for its critical role in pathogenicity .

What methodologies can be applied to study the impact of environmental conditions on PaDsbB2 expression and activity?

Understanding how environmental conditions affect PaDsbB2 expression and activity requires multi-faceted experimental approaches:

  • Transcriptional analysis:

    • qRT-PCR to measure dsbB2 transcript levels under different conditions

    • RNA-seq for genome-wide expression patterns

    • Promoter-reporter fusions (GFP, luciferase) to monitor expression in real-time

  • Protein level analysis:

    • Western blotting with specific antibodies against PaDsbB2

    • Mass spectrometry-based proteomics to quantify protein abundance

    • Pulse-chase labeling to determine protein turnover rates

  • Activity assays under varying conditions:

    • In vitro reconstitution of the PaDsbB2-PaDsbA1-quinone electron transfer chain

    • Measurement of electron transfer rates under different pH, temperature, ionic strength

    • Analysis of the impact of oxidative stress agents

  • Environmental simulation models:

    • Biofilm growth models mimicking lung infections or wound environments

    • Oxygen limitation studies reflecting conditions in cystic fibrosis lungs

    • Host-pathogen interaction models using cell culture or animal models

  • Genetic approaches:

    • Construction of regulated expression systems to control PaDsbB2 levels

    • CRISPR interference to modulate expression in response to specific signals

Table 2: Environmental Conditions Affecting DsbB Expression in Pseudomonas Species

Environmental ConditionEffect on dsbB1 ExpressionEffect on dsbB2 ExpressionMethod of Detection
Aerobic growthModerateHighRNA-seq, qRT-PCR
Anaerobic growthHighLowRNA-seq, qRT-PCR
Biofilm formationModerateHighPromoter-reporter fusion
Oxidative stress (H₂O₂)IncreasedModerate increaseqRT-PCR, proteomics
Iron limitationNo significant changeIncreasedRNA-seq, proteomics
Host cell contactIncreasedSignificantly increasedIn vivo expression technology
Antibiotic exposureVariable (drug-dependent)Variable (drug-dependent)Microarray, RNA-seq

Note: This table represents a compilation of expected results based on studies of disulfide bond formation systems and gene regulation in Pseudomonas species.

What are the best experimental designs for analyzing PaDsbB2 interaction with different quinone types?

Analyzing PaDsbB2 interactions with different quinones requires specialized biochemical and biophysical approaches:

  • Quinone-binding assays:

    • Isothermal titration calorimetry with purified PaDsbB2 and various quinones

    • Fluorescence quenching assays to measure binding affinities

    • Competition assays with labeled and unlabeled quinones

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy to measure rates of quinone reduction

    • Comparison of ubiquinone, menaquinone, and synthetic quinone analogs

    • Analysis of structure-activity relationships for quinone binding

  • Site-directed mutagenesis studies:

    • Identification of quinone-binding residues through sequence alignment with E. coli DsbB

    • Systematic mutation of predicted binding site residues

    • Kinetic characterization of mutants with different quinones

  • Reconstitution systems:

    • Proteoliposomes with defined lipid composition and incorporated quinones

    • Measurement of proton translocation coupled to quinone reduction

    • Analysis of membrane potential effects on quinone reduction

  • Structural approaches:

    • Co-crystallization attempts with quinone analogs

    • NMR studies of quinone binding using isotopically labeled proteins

    • Molecular dynamics simulations of quinone binding and reduction

Results from E. coli DsbB studies indicate that the protein directly oxidizes DsbA via disulfide exchange with the Cys104-Cys130 disulfide bond, with a rate constant of 2.7 × 10^5 M^-1 s^-1 . Similar experimental approaches can be adapted for PaDsbB2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.