Recombinant Pseudomonas aeruginosa Exoenzyme S synthesis protein C (exsC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification and additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
exsC; PA1710; Transcriptional anti-antiactivator ExsC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-145
Protein Length
Full Length of Mature Protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
exsC
Target Protein Sequence
LDEEGMASLLFDEQVGVTLLLLAERERLLLEADVAGIDVLGEGIFRQLASFNRHWHRFDL HFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCDSDREAVAAVGMR V
Uniprot No.

Target Background

Function
ExsC is a component of the regulatory cascade controlling the type III secretion system (T3SS) in *Pseudomonas aeruginosa*. It interacts with the antiactivator ExsD, inhibiting its activity and thereby enabling ExsA-mediated transcription.
Gene References Into Functions
  1. This study characterized the self-association states of ExsC, ExsD, and ExsE, as well as the binding interactions between ExsC and ExsE and ExsD. PMID: 17197437
Database Links

KEGG: pae:PA1710

STRING: 208964.PA1710

Subcellular Location
Cytoplasm.

Q&A

What is ExsC and what role does it play in Pseudomonas aeruginosa?

ExsC is a 14.3 kDa protein that functions as part of the exoenzyme S trans-regulatory locus in Pseudomonas aeruginosa. It plays a critical role in regulating the Type III Secretion System (TTSS) as an anti-anti-activator. Specifically, ExsC binds to the anti-activator ExsD, which normally inhibits the transcriptional activator ExsA. When ExsC sequesters ExsD under low Ca²⁺ conditions, ExsA is freed to activate transcription of TTSS genes, thereby coupling transcription to the secretion status of cells .

How is ExsC structurally and functionally related to other proteins in the ExsA-ExsD-ExsC regulatory cascade?

ExsC functions within a regulatory cascade where ExsA serves as the primary activator of TTSS gene transcription, while ExsD acts as an anti-activator by directly binding to and inhibiting ExsA. ExsC operates as an anti-anti-activator by binding to ExsD, preventing it from interacting with ExsA. This three-component regulatory system represents the first documented example of an anti-activator/anti-anti-activator pair controlling transcription of a Type III Secretion System . T7 expression analyses have confirmed that ExsC, ExsA, and a truncated form of ExsD are translated, with ExsC specifically encoding the 14.3 kDa product .

What are the optimal methods for recombinant expression and purification of ExsC?

For effective recombinant expression of ExsC, the T7 expression system in E. coli hosts (particularly strain K38 harboring the temperature-inducible T7 RNA polymerase gene on pGP1-2 plasmid) has proven successful . The methodology involves:

  • Cloning the exsC gene into a T7 expression vector (such as pT7-5)

  • Transforming the construct into an appropriate E. coli strain

  • Inducing expression through temperature shift

  • Purifying using affinity chromatography

For verification of expression, sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) followed by Western blot analysis using specific antibodies against ExsC is recommended .

What experimental approaches are most effective for studying ExsC-ExsD interactions?

Multiple complementary approaches have proven effective for investigating ExsC-ExsD interactions:

MethodApplicationAdvantagesLimitations
Bacterial two-hybrid assaysIn vivo detection of protein-protein interactionsAllows study in a cellular contextMay yield false positives
Co-purification assaysDirect biochemical evidence of interactionStrong evidence for physical bindingRequires purified proteins
RNase protection studiesExamining RNA processing and stabilityProvides insight into post-transcriptional regulationLabor intensive
Translational fusion with reporter genes (e.g., cat)Assess translation patternsQuantitative measurement of expressionFusion may affect protein function

These methods have been instrumental in demonstrating that ExsC interacts directly with ExsD to regulate TTSS transcription .

How does the exsC gene influence exoenzyme S production, and what methodologies best reveal these effects?

Complementation studies have shown that ExsC modulates the final yield of exoenzyme S but is not absolutely required for its expression. When translational stop codons are inserted within the exsC open reading frame, extracellular exoenzyme S activity is reduced two- to threefold (P < 0.001) compared to fully complemented strains .

To study these effects, researchers should:

  • Create defined mutations in exsC (insertional mutations, stop codons, or deletions)

  • Measure exoenzyme S production through:

    • ADP-ribosyltransferase activity assays

    • Western blot analysis of supernatant and lysate fractions

    • Radioanalytical analysis of exoenzyme S antigen

Research has shown that deletion of both exsC and the exsB region has less deleterious effects on exoenzyme S production than deletion of the exsB region alone, suggesting a complex regulatory interplay .

What statistical approaches are most appropriate for analyzing ExsC-related experimental data?

For ExsC research, appropriate statistical analyses depend on the experimental design and data characteristics. Based on established research protocols :

  • For comparing exoenzyme S activity between different mutant strains:

    • ANOVA followed by post-hoc tests (e.g., Tukey's) for multiple comparisons

    • t-tests for comparing two specific conditions

    • Report significance with appropriate p-values (typically P < 0.001 or P < 0.05)

  • For analyzing protein-protein interaction data:

    • Correlation analyses for co-localization studies

    • Fisher's exact test for categorical outcomes in two-hybrid assays

  • For interpreting gene expression data:

    • Normalization against housekeeping genes

    • Multiple comparison corrections (e.g., Bonferroni) when examining multiple genes

How does ExsC operate within the broader Type III Secretion System regulatory network?

ExsC functions as a critical component in a unique regulatory cascade controlling the P. aeruginosa Type III Secretion System. Under non-inducing conditions, ExsD binds to and inhibits ExsA, preventing transcription of TTSS genes. When environmental signals such as calcium depletion activate the type III secretion channel, ExsC binds to ExsD, liberating ExsA to activate transcription .

This regulatory system represents a novel mechanism whereby:

  • ExsA acts as the primary transcriptional activator

  • ExsD functions as an anti-activator by binding directly to ExsA

  • ExsC serves as an anti-anti-activator by sequestering ExsD

This cascade couples TTSS gene expression directly to the secretion status of the cells, ensuring that virulence factors are produced only when appropriate environmental conditions are detected .

What post-transcriptional processes affect ExsC function, and how can these be investigated?

Research indicates that post-transcriptional checkpoints play a significant role in exoenzyme S production, with ExsC potentially involved in translation or stability of ExoS . To investigate these processes:

  • RNase protection assays can be used to examine RNA stability and processing

  • Translational fusion experiments with reporter genes (such as chloramphenicol acetyltransferase) can assess translation patterns

  • Pulse-chase experiments can determine protein stability

Studies have revealed that while exsB was not translated, deletion of the exsB region affected the translation of ExsA-CAT, suggesting that the untranslated exsB region of the trans-regulatory locus mRNA mediates either the stability or translation of exsA . Similarly, ExsC may function to modulate exoenzyme S yields through post-transcriptional mechanisms.

What are the essential considerations when designing mutation studies for ExsC?

When designing mutation studies for ExsC, researchers should consider the following evidence-based guidelines:

  • Mutation strategy selection:

    • Insertional mutations (e.g., using the streptomycin resistance-encoding omega interposon)

    • Site-specific mutagenesis of start codons

    • Deletions of specific regions

    • Translational stop codons

  • Verification methods:

    • Southern blot analysis to confirm insertion and resolution of vector sequences

    • Sequencing to verify the precise nature of the mutation

  • Phenotypic analysis:

    • Western blot (immunoblot) analysis for protein expression

    • ADP-ribosyltransferase activity measurement

    • Analysis of extracellular protein profiles

  • Controls:

    • Include parental strains for comparison

    • Analyze both supernatant and lysate fractions

    • Test under both inducing and non-inducing conditions

Research has shown that insertional inactivation of the exoenzyme S trans-regulatory locus may affect a subset of other extracellular proteins, highlighting the importance of comprehensive phenotypic analysis .

What experimental design considerations are important when studying the relationship between ExsC, ExsD, and ExsA?

When investigating the regulatory relationships between ExsC, ExsD, and ExsA, researchers should implement a comprehensive experimental approach that includes :

  • Genetic manipulation strategies:

    • Create single, double, and triple mutants to assess epistatic relationships

    • Use complementation analyses with various combinations of genes

    • Employ site-directed mutagenesis to modify specific interaction domains

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation experiments

    • Surface plasmon resonance for binding kinetics

  • Functional assessments:

    • Reporter gene assays to measure transcriptional activity

    • Secretion assays under various calcium concentrations

    • Analysis of global gene expression changes using RNA-seq

  • Structural biology approaches:

    • X-ray crystallography of individual proteins and complexes

    • NMR studies for dynamic interaction analysis

The anti-anti-activator mechanism involving ExsC, ExsD, and ExsA represents the first example of this regulatory arrangement controlling a Type III Secretion System, making it particularly valuable for comparative studies with other bacterial regulatory systems .

How should researchers interpret conflicting data in ExsC functional studies?

When faced with conflicting data in ExsC functional studies, researchers should implement the following analytical approach:

  • Assess methodological differences:

    • Strain variations (studies have shown different results between PA103, PAO1, and PAK strains)

    • Expression systems (chromosomal vs. plasmid-based expression)

    • Experimental conditions (inducing vs. non-inducing)

  • Consider genetic context:

    • Chromosomal duplication and rearrangement events have been observed during recombination attempts with exsC in certain strains

    • The interplay between exsC and exsB regions adds complexity to data interpretation

  • Evaluate measurement techniques:

    • Direct protein detection (Western blot) vs. activity assays

    • Transcriptional vs. translational vs. post-translational effects

  • Statistical approaches:

    • Meta-analysis techniques when multiple studies exist

    • Effect size calculations rather than just p-value significance

    • Consideration of variability metrics alongside central tendency measures

Research has shown that deletion of both exsC and the exsB region has less deleterious effects on exoenzyme S production than deletion of the exsB region alone, demonstrating the complex nature of these regulatory interactions and the need for careful data interpretation .

What statistical methods are most appropriate for analyzing the effects of ExsC mutations on Type III Secretion System functionality?

For rigorous statistical analysis of ExsC mutation effects on TTSS functionality, researchers should employ:

  • Descriptive statistics:

    • Measures of central tendency (mean, median)

    • Measures of variability (standard deviation, range)

    • Data visualization through tables and graphs

  • Inferential statistics:

    • Parametric tests (t-tests, ANOVA) for normally distributed data

    • Non-parametric alternatives when normality assumptions are violated

    • Multiple comparison corrections for family-wise error rate control

    • Effect size calculations alongside p-values

  • Advanced analytical approaches:

    • Multivariate analysis for complex datasets with multiple dependent variables

    • Regression analyses to identify relationships between variables

    • Statistical power calculations to ensure adequate sample sizes

When reporting results, researchers should include both the statistical significance (p-value) and the magnitude of effect (effect size), as exemplified in studies reporting "a two- to threefold reduction in extracellular exoenzyme S activity (P < 0.001)" .

What are the most promising applications of ExsC research in combating Pseudomonas aeruginosa infections?

ExsC's role in regulating the Type III Secretion System, a major virulence mechanism in P. aeruginosa, positions it as a potential target for novel therapeutic approaches:

  • Anti-virulence strategies:

    • Disrupting ExsC-ExsD interactions could prevent TTSS activation

    • Small molecule inhibitors targeting this interaction could reduce virulence without selecting for resistance

    • Peptide mimetics could be designed based on interaction domains

  • Diagnostic applications:

    • ExsC expression levels could serve as biomarkers for virulent strains

    • Detection of active TTSS through ExsC-related markers could guide treatment decisions

  • Vaccine development:

    • ExsC or related proteins could be explored as potential vaccine components

    • Understanding the regulatory cascade could inform attenuated strain development

  • Combination therapies:

    • Anti-ExsC approaches could potentially sensitize bacteria to conventional antibiotics

    • Targeting multiple components of the regulatory cascade might prevent resistance development

These applications build upon the fundamental understanding that ExsC occupies a critical position in a unique regulatory cascade controlling virulence expression in a major opportunistic pathogen responsible for significant morbidity and mortality .

What advanced research methods should be applied to further elucidate the structural basis of ExsC interactions?

To advance our understanding of the structural basis of ExsC interactions, several cutting-edge methodologies should be applied:

  • High-resolution structural techniques:

    • Cryo-electron microscopy to visualize protein complexes

    • X-ray crystallography of ExsC alone and in complex with ExsD

    • NMR spectroscopy for dynamic interaction studies

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Computational approaches:

    • Molecular dynamics simulations to model conformational changes

    • Protein-protein docking to predict interaction interfaces

    • Machine learning methods to identify potential binding partners

  • Advanced genetic and molecular techniques:

    • CRISPR-Cas9 for precise genome editing

    • Single-molecule fluorescence techniques to observe interactions in real-time

    • Proximity labeling approaches to identify near-neighbor proteins in vivo

  • Systems biology integration:

    • Multi-omics approaches (proteomics, transcriptomics, metabolomics)

    • Network analysis to place ExsC within the broader virulence regulation network

    • Mathematical modeling of the regulatory cascade

These advanced methods would build upon existing research data demonstrating that ExsC interacts with ExsD in bacterial two-hybrid and co-purification assays , potentially revealing new therapeutic targets and fundamental insights into bacterial virulence regulation.

What core competencies should researchers develop for effective ExsC research?

Successful ExsC research requires proficiency in specific competencies that span multiple disciplines:

  • Technical laboratory skills:

    • Molecular cloning and recombinant protein expression

    • Protein purification techniques

    • Bacterial culture methods specific to Pseudomonas aeruginosa

    • Protein-protein interaction assays

    • Enzymatic activity assays

  • Data analysis capabilities:

    • Statistical analysis of experimental data

    • Bioinformatics for sequence analysis and structure prediction

    • Data visualization techniques

  • Experimental design expertise:

    • Understanding of control selection

    • Ability to design complementation studies

    • Proficiency in mutation analysis approaches

  • Specialized knowledge areas:

    • Type III Secretion Systems

    • Bacterial gene regulation mechanisms

    • Pseudomonas aeruginosa pathogenesis

    • Protein structure-function relationships

Research institutions often provide these competencies through structured graduate programs in exercise science, microbiology, or related fields that emphasize research methods, experimental design, and data analysis .

How can researchers effectively design a comprehensive study plan for investigating ExsC's regulatory mechanisms?

A well-designed study plan for investigating ExsC's regulatory mechanisms should include:

  • Literature review and hypothesis development:

    • Systematic review of existing literature on ExsC, ExsD, and ExsA interactions

    • Identification of knowledge gaps and formulation of testable hypotheses

    • Development of a conceptual framework linking ExsC to TTSS regulation

  • Sequential experimental approach:

    • Start with genetic studies (mutations, complementation)

    • Progress to protein expression and purification

    • Conduct interaction studies (two-hybrid, co-purification)

    • Perform functional assays (transcriptional, translational, secretion)

    • Conclude with structural studies

  • Validation strategies:

    • Use multiple strains (PA103, PAO1, PAK) to account for strain-specific effects

    • Employ both in vitro and in vivo approaches

    • Verify key findings through independent methodologies

  • Timeline and resource allocation:

    • Plan for potential challenges (e.g., protein solubility issues)

    • Allocate adequate time for optimization steps

    • Schedule regular data analysis and hypothesis refinement points

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.