Recombinant Pseudomonas aeruginosa Flagellar M-ring protein (fliF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its incorporation.
Synonyms
fliF; PA1101; Flagellar M-ring protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
fliF
Target Protein Sequence
MADALIDSQVPAKSGGAGMLKKSFPGLSFLDNLSEMTMLRQIGLLVGLAASVAIGFAVVL WSQQPDYKPLYGSLNGVDANRVVEALTAADIPYKVEPNSGALLVKADDLGRARMKVASAG VAPTDNNVGFEILDKEQALGTSQFMEATNYRRGLEGELARTVSSLNNVKAARVHLAIPKS SVFVRDDRKPSASVLVELYPGRSLEPSQVMAIVNLVATSVPELDKSQVTVVDQKGNLLSD QQELSELTMAGKQFDFTRRMEGLLTQRVHNILQPVLGNGRYKAEVSADVDFSAVESTSEM YNPDQPALRSEQRNNEERQNSSGPQGVPGALSNQPPGPASAPQQATASAPADYVAPGQPL KDANGQTIIDPKTGKPELAPYPTDKRDQTTRNYELDRSISYTKQQQGRLRRLSVAVVLDD QMKVDAKTGEVSHQPWSADELARFTRLVQDSVGYDASRGDSVSVINAPFAPAQAEEIDSI PFYSQPWFWDIVKQVLGVLFILVLVFGVLRPVLSNITGGGKGKSLAGGGGRDGDLALGES GLEGSLADDRVSIGGPSSILLPSPTEGYDAQLNAIKNLVAQDPGRVAQVVKEWINADE
Uniprot No.

Target Background

Function

The M ring is believed to play an active role in energy transduction.

Database Links

KEGG: pae:PA1101

STRING: 208964.PA1101

Protein Families
FliF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

Basic Research Questions

  • What is the structure and function of the FliF protein in Pseudomonas aeruginosa?

FliF is the primary structural component of the MS-ring complex in the flagellar basal body. The protein consists of approximately 560 amino acids with two transmembrane helices that anchor it to the cytoplasmic membrane. Between these transmembrane regions, FliF possesses a large periplasmic domain comprising three structurally similar globular domains termed Ring-Building Motifs (RBM1, RBM2, and RBM3) . These RBMs possess a common fold and show structural homology with components of the Type III Secretion System (T3SS) injectisome . FliF serves as the fundamental scaffold for flagellar structure and assembly, forming the membrane and supramembrane rings . Recent structural studies have shown that the MS-ring exhibits multiple symmetries within its structure, with the RBM3 domain forming a 34-mer stoichiometry, while RBM2 adopts two distinct positions, including a 23-mer ring .

  • How does FliF contribute to bacterial pathogenesis in P. aeruginosa infections?

FliF plays a critical role in P. aeruginosa pathogenesis through multiple mechanisms:

  • Motility-dependent colonization: As the structural foundation of the flagellar apparatus, FliF enables bacterial motility, which is essential for initial colonization of mucosal surfaces .

  • Adhesion to host tissues: Studies have demonstrated that FliF is essential for adhesion to mucin, a major component of respiratory secretions. P. aeruginosa fliF mutants are both nonmotile and nonadhesive to mucin .

  • Basal body localization of adhesins: FliF appears to be required for the proper localization of non-pilus adhesins that bind to mucin, highlighting its indirect role in adhesion .

  • Immune response modulation: The flagellar structure formed with FliF as its foundation interacts with host immune receptors, potentially contributing to inflammatory responses .

  • What experimental approaches can be used to express and purify recombinant P. aeruginosa FliF?

Recombinant P. aeruginosa FliF can be expressed and purified using the following approaches:

Expression systems:

  • E. coli expression: Most common approach using pET vector systems with T7 promoter for high-level expression .

  • Yeast expression: Can be used for proper folding of complex domains, as demonstrated with other flagellar proteins .

Purification strategies:

  • Affinity chromatography: His-tag fusion proteins can be purified using Ni-NTA columns .

  • Size exclusion chromatography: Essential for separating monomeric and oligomeric forms of FliF.

  • Ion exchange chromatography: Can be used as an additional purification step.

Solubility considerations:

  • Detergent-based extraction (e.g., using mild non-ionic detergents like DDM or LDAO) is typically required due to the membrane-associated nature of FliF.

  • Truncated constructs containing only the periplasmic domains (RBM1-RBM2-RBM3) may show improved solubility compared to the full-length protein .

  • What phenotypes result from fliF gene mutations in P. aeruginosa?

Mutations in the P. aeruginosa fliF gene produce several distinct phenotypes:

  • Complete loss of motility: fliF mutants are non-motile due to inability to form the MS-ring, which is essential for flagellar assembly .

  • Elimination of mucin adhesion: fliF mutants lose their ability to adhere to mucin, suggesting a role in proper localization of adhesins .

  • Altered biofilm formation: Although not directly demonstrated in the search results, flagellar defects typically affect biofilm formation capabilities.

  • Reduced virulence: The motility and adhesion defects contribute to decreased virulence in infection models.

These phenotypes can be complemented by providing the fliF gene in trans in some specific mutants (e.g., PAK-RR20), but polar effects on downstream genes can complicate complementation in other types of mutations (e.g., PAK-NPF) .

Advanced Research Questions

  • How does the oligomerization process of FliF differ between peritrichous and non-peritrichous bacteria?

The oligomerization process of FliF exhibits significant differences between peritrichous bacteria (with flagella distributed around the cell) and non-peritrichous bacteria (with polar flagella):

Peritrichous bacteria (e.g., Salmonella Typhimurium):

  • FliF can spontaneously oligomerize in vitro to form the MS-ring structure .

  • Overexpression of FliF alone leads to assembly of MS-ring structures .

  • Does not require additional flagellar components for basic assembly.

Non-peritrichous bacteria (e.g., Vibrio alginolyticus, Helicobacter pylori):

  • FliF remains in a monomeric state in vitro .

  • Requires additional factors such as FlhF for efficient assembly .

  • In Vibrio, co-expression of FlhF and FliG promotes MS-ring formation .

  • FlhF appears to recruit FliF to the cell pole, increasing local concentration and facilitating oligomerization .

These differences are likely related to the distinct regulatory mechanisms controlling flagellar localization and number in different bacterial species. Non-peritrichous bacteria employ FlhF and FlhG proteins for flagellar regulation, which are absent in peritrichous bacteria like E. coli and S. Typhimurium .

  • What molecular mechanisms control the assembly of the MS-ring, and how do different domains of FliF contribute to ring formation?

The assembly of the MS-ring involves multiple molecular mechanisms and domain-specific contributions:

Initiation and nucleation:

  • Recent evidence suggests that a dimer of FliF with two different conformations may initiate MS-ring assembly .

  • The well-conserved DQxGxxL motif in the RBM2-RBM3 hinge loop allows RBM2 to adopt two different orientations relative to RBM3, which is critical for establishing the complex symmetry of the MS-ring .

Domain-specific contributions:

  • RBM3 domains: Form a 34-fold symmetric ring that serves as the outer framework of the MS-ring .

  • RBM2 domains: 23 of the 34 RBM2 domains form an inner ring with a central pore that accommodates the flagellar protein export complex, while the remaining 11 RBM2 domains form 11 cog-like structures with RBM1 domains just outside the inner ring .

  • RBM1 domains: Contribute to the formation of cog-like structures with a subset of RBM2 domains .

Symmetry establishment:

  • The MS-ring exhibits multiple symmetries within one structure through the assembly of FliF subunits in two different conformations with distinct arrangements of the three RBM domains .

  • This symmetry mismatch is essential for accommodating other flagellar components and establishing the correct spatial organization for flagellar assembly.

  • What are the regulatory pathways controlling fliF gene expression in P. aeruginosa?

The regulation of fliF gene expression in P. aeruginosa involves several regulatory pathways:

Operon structure and transcriptional units:

  • The fliF gene is part of an operon that includes fliE and fliG genes .

  • Transcription typically initiates from a promoter upstream of the fliE gene .

Sigma factor involvement:

  • Unlike some flagellar genes that are dependent on the flagellar sigma factor σ28 (RpoF), the fliE promoter (which drives fliF expression) does not utilize RpoF or RpoN (σ54) sigma factors .

  • This distinguishes the regulation of fliF from other flagellar genes like fliC.

Regulatory proteins:

  • While not directly shown for fliF, other flagellar genes in P. aeruginosa are regulated by FlhF and FlhG in non-peritrichous species .

  • The fliD gene, which encodes another flagellar component, is regulated by FleQ and RpoN , suggesting potential similar regulation for other flagellar genes.

Internal promoters:

  • Experimental evidence suggests that there is no functional internal promoter within the fliF gene itself, as demonstrated by complementation experiments with different mutants .

Understanding these regulatory pathways is crucial for designing expression systems for recombinant FliF production.

  • How can structural information about FliF be leveraged for antimicrobial drug development?

Structural information about FliF can be leveraged for antimicrobial drug development through several strategic approaches:

Targeting critical interfaces:

  • The interfaces between FliF subunits in the MS-ring represent potential targets for small molecules that could disrupt oligomerization .

  • The conserved DQxGxxL motif in the RBM2-RBM3 hinge loop is particularly important for establishing different conformations and could be a specific target .

Inhibiting protein-protein interactions:

  • The interaction between FliF and FliG is essential for flagellar assembly, making this interface a potential target .

  • FliF also interacts with FliL, which is required for optimal flagellar function during swarming motility .

Structure-based virtual screening approaches:

  • High-resolution structural data on FliF domains can enable virtual screening of chemical libraries to identify molecules that bind to critical regions.

  • Molecular dynamics simulations can help predict conformational changes and identify cryptic binding sites.

Potential advantages as a drug target:

  • FliF is exposed to the periplasmic space, potentially making it more accessible to small molecules than cytoplasmic targets.

  • FliF is highly conserved among pathogens but absent in humans, reducing the risk of off-target effects.

  • Targeting motility rather than viability may reduce selective pressure for resistance development.

The recent development of a flagellin-based vaccine using ferritin nanoparticles (reFliC-FN) demonstrates the feasibility of targeting flagellar components for therapeutic development .

  • What methodologies can be used to study FliF-dependent protein export and its role in flagellar assembly?

Several methodologies can be employed to study FliF-dependent protein export and its role in flagellar assembly:

Genetic approaches:

  • Conditional mutants: Temperature-sensitive or inducible fliF mutants allow controlled expression to study assembly dynamics.

  • Fluorescent protein fusions: Tagging FliF or export substrates with fluorescent proteins to visualize localization and export in real-time .

  • Site-directed mutagenesis: Identifying critical residues involved in export function by creating specific mutations in the FliF central pore region .

Biochemical techniques:

  • In vitro reconstitution: Purified FliF proteins can be reconstituted into liposomes to study protein translocation.

  • Pull-down assays: Identifying interaction partners of FliF involved in the export process .

  • Cross-linking experiments: Capturing transient interactions during the export process.

Structural methods:

  • Cryo-electron microscopy: Visualizing the MS-ring structure at different stages of assembly and during protein export .

  • Single-particle analysis: Determining conformational changes in the FliF ring during export.

Functional assays:

  • Secretion assays: Measuring the export of early, middle, and late flagellar substrates in wild-type versus fliF mutant strains.

  • Motility assays: Correlating export function with swimming and swarming capabilities.

These methodologies can provide comprehensive insights into how the FliF-formed MS-ring coordinates flagellar protein export during assembly.

  • How do FliF-dependent flagellar structures contribute to bacterial adaptation in different host environments?

FliF-dependent flagellar structures contribute to bacterial adaptation in different host environments through several mechanisms:

Environment-specific regulation:

  • In Pseudomonas aeruginosa infections, the flagellum plays dual roles in motility and adhesion, particularly to respiratory mucins .

  • Different epidemic clones of P. aeruginosa show varying host preferences (CF versus non-CF patients) and may adapt their flagellar expression patterns accordingly .

Immune evasion strategies:

  • The flagellar structure can both trigger and evade host immune responses.

  • Some bacterial adaptations involve downregulation of flagellar expression to avoid immune recognition during chronic infection.

  • Differences in DksA1 expression across epidemic clones may explain varying abilities to survive within macrophages and host preferences .

Biofilm formation and persistence:

  • The flagellum is crucial for initial surface attachment in biofilm formation.

  • Transition from motile to sessile lifestyles often involves regulated changes in flagellar expression.

Experimental approaches to study adaptation:

  • Transcriptomic analysis: Comparing flagellar gene expression patterns between environmental and clinical isolates.

  • Evolution experiments: Observing changes in flagellar structure during serial passage in different host environments.

  • Host-pathogen interaction models: Using macrophage survival assays and animal infection models to assess the role of flagellar structures in adaptation .

  • What are the challenges and solutions for studying FliF oligomerization in vitro?

Studying FliF oligomerization in vitro presents several challenges with corresponding solutions:

Challenges:

  • Membrane protein solubility: FliF is a membrane-embedded protein with transmembrane domains, making it difficult to solubilize while maintaining native conformation.

  • Oligomerization dynamics: The process may require specific conditions or additional factors, especially in non-peritrichous bacteria.

  • Complex symmetry: The MS-ring formed by FliF exhibits unusual symmetry with domains adopting different conformations.

  • Size heterogeneity: Intermediate oligomeric states during assembly complicate analysis.

Solutions and methodologies:

  • Protein expression and purification:

    • Using truncated constructs focusing on periplasmic domains (RBM1-RBM2-RBM3) .

    • Employing mild detergents or amphipols for solubilization.

    • Co-expression with chaperones to improve folding.

  • Oligomerization analysis:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine absolute molecular mass of complexes .

    • Analytical ultracentrifugation to characterize assembly dynamics and intermediate states.

    • Native mass spectrometry for stoichiometry determination.

  • Structural characterization:

    • Negative-stain electron microscopy for rapid visualization of ring structures.

    • Cryo-electron microscopy for high-resolution structural analysis.

    • Cross-linking mass spectrometry to identify interaction interfaces.

  • Co-reconstitution approaches:

    • Including potential assembly factors like FlhF and FliG for non-peritrichous species .

    • Reconstitution into liposomes or nanodiscs to mimic membrane environment.

  • Real-time assembly monitoring:

    • Fluorescence-based assays using labeled FliF monomers to track assembly kinetics.

These approaches can help overcome the challenges and provide insights into the complex oligomerization process of FliF.

Table 1: Comparison of fliF Genes and Their Regulation Across Bacterial Species

Bacterial SpeciesFliF Size (aa)Number of MS-ring SubunitsAssembly RequirementsRegulatory FactorsReference
Pseudomonas aeruginosa~56034UnknownNot RpoF or RpoN dependent
Salmonella Typhimurium55234Self-assembly-
Vibrio alginolyticus--Requires FlhF and FliGFlhF, FlhG
Helicobacter pylori--Additional factors required-
Escherichia coli--Cooperative process with FlhA-

Table 2: Functional Domains of P. aeruginosa FliF and Their Roles

DomainLocationFunctionStructural FeaturesInteractionsReference
Transmembrane helicesN- and C-terminal regionsMembrane anchoringα-helicalMembrane lipids
RBM1PeriplasmicForms part of cog-like structuresHomology to T3SS protein SctJRBM2
RBM2PeriplasmicForms inner ring (23 subunits) and cog-like structures (11 subunits)Contains DQxGxxL motif in RBM2-RBM3 hingeRBM1, RBM3
RBM3PeriplasmicForms 34-subunit ringHomology to SpoIIIAG proteinRBM2, possibly FliG
C-terminal regionCytoplasmicInteraction with FliG-FliG, possibly FliL

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.