Recombinant Pseudomonas aeruginosa Flagellar protein fliO (fliO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
fliO; PA1445; Flagellar protein FliO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
fliO
Target Protein Sequence
MRRYLFAGFLPALASLSAPLCAAEGTTGAAAPTVGAASGAAAQLAQLVLGLGLVIGLIFL LAWLVRRVQQAGPRGNRLIRTLASQPLGPRDRLVLVQVGEEQILLGLTPGRITPLHVLKE PVHLPDGEPATPEFAQRLLELLNKDPKGKP
Uniprot No.

Target Background

Function

Recombinant Pseudomonas aeruginosa Flagellar protein fliO (fliO) is involved in flagellar biosynthesis and bacterial adherence. It plays a potential role in the accurate localization of flagellar components and in the surface localization and assembly of adhesins.

Database Links

KEGG: pae:PA1445

STRING: 208964.PA1445

Protein Families
FliO/MopB family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the role of the fliO gene in Pseudomonas aeruginosa?

The fliO gene encodes a protein that is integral to the flagellar biosynthesis and adherence mechanisms of Pseudomonas aeruginosa. It is part of the type III secretion system, which facilitates the export of flagellar proteins necessary for motility. Mutations in fliO result in nonmotile phenotypes and impaired adherence to mucins and eukaryotic cells. This suggests that fliO plays a dual role in motility and adhesion, potentially regulating non-pilus-mediated adherence mechanisms .

How does fliO contribute to flagellar assembly?

FliO acts as a component of the flagellar export apparatus, which is responsible for transporting structural proteins across the bacterial membrane. Its function appears to be conserved across species, as homologs in Salmonella typhimurium and Escherichia coli also participate in flagellar protein export. Experimental studies have shown that FliO localizes to the membrane fraction due to its hydrophobic nature, indicating its role in anchoring or stabilizing the export machinery .

How is the expression of fliO regulated?

The expression of fliO is closely linked to other flagellar genes within an operon structure. In Pseudomonas aeruginosa, transcriptional regulators such as FleQ and alternate sigma factors like RpoN (σ54) play crucial roles in modulating its expression. Unlike some other flagellar genes, fliO transcription does not depend on σ28, highlighting a unique regulatory pathway .

What experimental methods are used to study fliO function?

To investigate the function of fliO, researchers commonly employ transposon mutagenesis to create nonfunctional alleles, followed by complementation assays to restore phenotypes. Protein localization studies using membrane fractionation and expression systems such as T7 RNA polymerase are also utilized. Additionally, adherence assays with mucins or epithelial cells help elucidate its role in bacterial adhesion .

Are there homologs of fliO in other bacterial species?

Yes, homologs of fliO have been identified in several bacterial species, including Salmonella typhimurium and Escherichia coli. These homologs share functional similarities, particularly in their involvement in flagellar biosynthesis and protein export. Comparative genomic analyses reveal conserved sequences and structural motifs across different species .

What are the molecular mechanisms underlying fliO-mediated adherence?

The exact molecular mechanisms remain under investigation, but evidence suggests that FliO may influence the localization or regulation of non-pilus adhesins. In Pseudomonas aeruginosa, mutants lacking functional fliO fail to adhere to mucins despite retaining other adhesion factors like pili. This indicates that FliO interacts with specific components required for mucin binding, potentially through its role in protein export or membrane localization .

How does fliO interact with other components of the flagellar export apparatus?

FliO is part of a larger operon that includes genes encoding other export apparatus components such as FliP, FliQ, and FliR. These proteins collectively form a type III secretion system essential for flagellar assembly. Studies using site-directed mutagenesis have shown that alterations in FliP processing can impact FliO function, suggesting interdependence among these proteins .

What are the implications of fliO mutations for bacterial pathogenicity?

Mutations in fliO significantly reduce the ability of Pseudomonas aeruginosa to adhere to host tissues, which is a critical step in colonization and infection. For instance, cystic fibrosis patients often suffer from chronic lung infections caused by this bacterium's ability to adhere to respiratory mucins. Therefore, impairing FliO function could serve as a potential strategy for mitigating infections .

How does FliO contribute to motility-independent adhesion mechanisms?

Interestingly, some studies have shown that while motility-deficient mutants lacking functional flagella can still adhere to mucins, those with disrupted fliO cannot. This suggests that FliO's role extends beyond motility and includes specific contributions to adhesion pathways independent of flagellin production or assembly .

What experimental challenges exist when studying recombinant FliO protein?

Recombinant expression and purification of FliO have proven challenging due to its hydrophobic nature and tendency to aggregate. Attempts to overexpress FliO using heterologous systems often result in low yields or misfolded proteins. Optimizing expression conditions—such as using detergents or co-expressing chaperones—can improve solubility and functionality for downstream applications .

How can researchers design experiments to study fliO's role in adherence?

To study adherence functions, researchers can use transposon mutants deficient in fliO and perform complementation assays with plasmids carrying wild-type alleles. Adherence assays using epithelial cell cultures or purified mucins provide quantitative data on binding efficiency. Additionally, imaging techniques like fluorescence microscopy can visualize bacterial attachment under different conditions .

What techniques are used for analyzing protein-protein interactions involving FliO?

Protein-protein interactions can be studied using co-immunoprecipitation (Co-IP) followed by mass spectrometry to identify binding partners of FliO within the flagellar export apparatus. Yeast two-hybrid screens and surface plasmon resonance (SPR) are also valuable tools for characterizing direct interactions at a molecular level .

How can structural studies advance our understanding of FliO function?

High-resolution techniques such as X-ray crystallography or cryo-electron microscopy (cryo-EM) can reveal the three-dimensional structure of FliO and its interactions with other export apparatus components. Structural data can provide insights into how mutations or conformational changes affect its function .

What computational approaches are useful for studying fliO?

Bioinformatics tools can predict secondary structures, transmembrane domains, and potential interaction sites within FliO based on its amino acid sequence. Molecular dynamics simulations can model how FliO integrates into membranes or interacts with other proteins under various conditions .

How do environmental conditions affect FliO expression and function?

Environmental factors such as temperature, pH, and nutrient availability can influence the expression levels and functionality of FliO. For example, stress conditions that mimic host environments may upregulate genes involved in adhesion and motility pathways through regulatory networks involving FleQ and RpoN .

Data Tables

To provide additional clarity on key findings related to recombinant Pseudomonas aeruginosa flagellar protein fliO (fliO), here are summarized data tables based on experimental results:

Study ComponentExperimental FindingsReference
Adherence AssaysMutants lacking fliO exhibit reduced binding to mucins compared to wild-type strains
Protein LocalizationFliO localizes predominantly within membrane fractions due to its hydrophobic properties
Regulatory PathwaysExpression controlled by FleQ/RpoN; independent of σ28
Homologous GenesConserved across multiple species (E.coli, S.typhimurium)
Mutational ImpactSite-directed mutations impair motility but do not completely abolish protein functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.