Recombinant Pseudomonas aeruginosa Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Overview of PlsY

PlsY is a membrane-integral acyltransferase that catalyzes the committed step in bacterial phospholipid synthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid . Unlike eukaryotic acyltransferases, PlsY operates without conserved catalytic motifs or homologs in higher organisms, making it a unique antibacterial target . The recombinant form of this enzyme is produced in E. coli systems for biochemical and structural studies .

Recombinant PlsY Production and Characteristics

The recombinant enzyme (UniProt ID: B7V4G7) is commercially available with the following specifications :

ParameterDetail
Source organismPseudomonas aeruginosa (strain LESB58)
Expression systemE. coli
Purity>85% (SDS-PAGE verified)
Storage-20°C/-80°C (6–12 months stability)
ReconstitutionDeionized water + 50% glycerol (0.1–1.0 mg/mL concentration recommended)

This recombinant form retains enzymatic activity, enabling studies on inhibitor screening and catalytic mechanisms .

Enzymatic Function and Research Findings

  • Mechanism: PlsY uses acyl-phosphate as an acyl donor, a distinct feature compared to acyl-CoA-dependent eukaryotic systems .

  • Role in virulence: Disruption of G3P homeostasis (via GlpD mutation) impairs P. aeruginosa growth, pyocyanin synthesis, and antibiotic resistance .

  • Therapeutic potential: PlsY inhibitors could exploit its essential role in phospholipid biosynthesis, as demonstrated by high-throughput enzymatic assays .

Applications in Antimicrobial Development

PlsY’s unique mechanism and absence in humans make it a promising target. Key research directions include:

  • Virtual screening: Leveraging its crystal structure for inhibitor discovery .

  • Transcriptomic links: G3P accumulation reduces glycolysis and ATP synthesis in P. aeruginosa, suggesting combinatorial targeting with PlsY inhibitors .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments include standard blue ice packs. If you require dry ice packaging, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
plsY; PA0581; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Target Names
plsY
Target Protein Sequence
MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLRVAGKKLAILTLLGDV GKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKGVATAAGMLLGLYPPAV LLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPMTVLTGLIVWRHRANLRD LFAGRERHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: pae:PA0581

STRING: 208964.PA0581

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (PlsY) and what is its role in Pseudomonas aeruginosa?

Glycerol-3-phosphate acyltransferase (PlsY) is a critical enzyme in P. aeruginosa that catalyzes the rate-limiting step of glycerolipid biosynthesis. Specifically, it mediates the acylation of glycerol 3-phosphate with saturated long chain acyl-CoAs, a fundamental process in bacterial membrane formation. In P. aeruginosa, this enzyme is integral to cellular membrane integrity and contributes to the pathogen's survival mechanisms, particularly in hostile environments such as the Cystic Fibrosis (CF) lung, where it must withstand various stressors including antibiotics and host immune responses .

The enzyme functions within a complex network of lipid metabolism pathways that are essential for bacterial growth and virulence. Understanding PlsY's structural and functional properties is crucial for comprehending P. aeruginosa pathogenicity and developing targeted therapeutic strategies.

How does genetic recombination affect PlsY expression and function in Pseudomonas aeruginosa?

Genetic recombination plays a significant role in modulating PlsY expression and function in P. aeruginosa populations. Research has demonstrated that recombination, rather than spontaneous mutation, is the dominant driver of diversity in P. aeruginosa populations during chronic infections, such as those found in CF patients . This recombination leads to phenotypic and genotypic variances that can affect enzyme production and function.

The phenotypic differences between P. aeruginosa isolates are often not linked to mutations in known genes but instead are statistically associated with distinct recombination events . For PlsY specifically, recombination events can modify regulatory regions or coding sequences, leading to altered enzyme expression levels or function. These modifications can contribute to the bacterial population's adaptability to changing environments and selective pressures, including antibiotic treatment.

What are the standard methods for expressing recombinant PlsY from Pseudomonas aeruginosa?

Recombinant PlsY from P. aeruginosa can be expressed using several standardized molecular biology techniques. The typical approach involves:

  • Gene isolation and cloning: The plsY gene is amplified from P. aeruginosa genomic DNA using PCR with specific primers designed to include appropriate restriction sites.

  • Vector construction: The amplified gene is inserted into an expression vector containing:

    • A strong promoter (e.g., T7 promoter)

    • A selection marker (typically antibiotic resistance)

    • A fusion tag for purification (commonly His-tag or GST-tag)

  • Transformation and expression: The recombinant vector is transformed into an appropriate expression host. While E. coli is commonly used (particularly BL21(DE3) strains), for proper folding and function of P. aeruginosa proteins, modified P. aeruginosa expression systems may be employed .

  • Protein purification: The recombinant PlsY protein can be purified using affinity chromatography based on the fusion tag, followed by size exclusion chromatography to achieve high purity .

For enhanced expression, researchers often optimize codon usage for the host organism and may use strains designed to express rare tRNAs if the P. aeruginosa gene contains rare codons relative to the expression host.

How can I design effective inhibitors for Pseudomonas aeruginosa PlsY?

Designing effective inhibitors for P. aeruginosa PlsY requires a comprehensive structure-activity relationship approach. Based on current research on GPAT inhibitors, the following methodological framework is recommended:

  • Structural basis for inhibitor design: Design compounds that mimic the enzyme's natural substrates with modifications that enhance binding while preventing catalysis. For GPAT inhibitors, successful designs often include:

    • A negatively charged group to mimic the phosphate of glycerol-3-phosphate

    • A long saturated chain to mimic the acyl-CoA substrate

    • A sulfonamide linker that mimics the transition state of the acylation reaction

  • Compound screening approach: Test synthesized compounds in a systematic manner using:

    • Initial screening with recombinant enzyme in cell-free assays

    • Secondary screening in intact mitochondrial assays for GPAT

    • Tertiary screening in bacterial culture systems

  • Evaluation metrics: Assess inhibitor efficacy through:

    • IC50 determination (concentration required for 50% inhibition)

    • Structure-activity relationship analysis

    • Specificity testing against related enzymes

For example, compounds like 2-(nonylsulfonamido)benzoic acid have shown moderate GPAT inhibitory activity in intact mitochondrial assays . Similar structural scaffolds could be explored for P. aeruginosa PlsY inhibition.

Table 1: Example Structure-Activity Relationship Data for Potential PlsY Inhibitors

Compound StructureModificationIC50 Value (μM)Selectivity Index*
Benzoic acid with C9 sulfonamideParent compound45-751.0
Benzoic acid with C12 sulfonamideExtended chain25-401.8
Phosphonic acid with C9 sulfonamideAltered head group30-551.5
Benzoic acid with C9 sulfonamide (ortho)Position isomer50-800.9

*Selectivity Index = (IC50 for related enzymes) / (IC50 for PlsY)

These compounds should be designed with consideration for bacterial membrane permeability and potential efflux pump susceptibility, which are particularly relevant for P. aeruginosa therapeutics .

What are the best approaches to study PlsY's role in Pseudomonas aeruginosa virulence and antibiotic resistance?

Investigating PlsY's role in P. aeruginosa virulence and antibiotic resistance requires a multifaceted approach combining genetic, biochemical, and phenotypic analyses:

  • Genetic manipulation strategies:

    • Gene knockout or knockdown using CRISPR-Cas systems or homologous recombination

    • Construction of point mutations in catalytic residues

    • Controlled expression systems (inducible promoters)

    • Site-directed mutagenesis to modify specific functional domains

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Membrane integrity assays (e.g., fluorescent dye uptake)

    • Virulence factor production assessment

    • Biofilm formation quantification

    • Quorum sensing signal measurement

  • Antibiotic susceptibility testing:

    • Standard minimum inhibitory concentration (MIC) determination

    • Combination therapy efficacy assessment

    • Mixed population resistance testing (critical as resistance significantly increases when multiple isolates are mixed)

    • Time-kill curves under antibiotic pressure

  • In vivo infection models:

    • Mouse pulmonary infection models

    • Galleria mellonella (wax moth) infection model

    • Cell culture infection systems

When studying the relationship between PlsY function and antibiotic resistance, it's particularly important to characterize multiple isolates, as P. aeruginosa populations show high phenotypic diversity even when morphologically identical . This diversity, driven by recombination rather than spontaneous mutation, significantly affects antibiotic resistance profiles.

How can computational approaches aid in understanding PlsY structure and function?

Computational methodologies provide powerful tools for investigating PlsY structure and function, offering insights that may be challenging to obtain through experimental methods alone:

  • Homology modeling and structure prediction:

    • Generate 3D structural models based on related enzymes with known crystal structures

    • Refine models using molecular dynamics simulations

    • Predict substrate binding sites and catalytic residues

  • Molecular docking studies:

    • Virtual screening of potential inhibitors

    • Analysis of substrate binding modes

    • Identification of allosteric sites

  • Molecular dynamics simulations:

    • Study protein flexibility and conformational changes

    • Investigate enzyme-substrate interactions over time

    • Analyze the impact of mutations on protein stability and function

  • Systems biology approaches:

    • Metabolic network analysis to understand the impact of PlsY activity on cellular metabolism

    • Flux balance analysis to predict the effects of PlsY inhibition

  • Machine learning applications:

    • Development of predictive models for enzyme-inhibitor interactions

    • QSAR (Quantitative Structure-Activity Relationship) analysis for inhibitor optimization

    • Pattern recognition in genomic data to identify regulatory elements

Computational workflows like those developed for recombinant antibody design can be adapted for studying enzyme-substrate and enzyme-inhibitor interactions . These approaches can accelerate the design and screening process, reducing the time and resources required for experimental validation.

How should I approach contradictory data when studying PlsY enzyme kinetics?

When confronted with contradictory data in PlsY enzyme kinetics studies, a systematic analytical approach is essential:

  • Initial data verification:

    • Thoroughly examine raw data for technical errors or outliers

    • Verify the integrity of reagents, particularly the recombinant enzyme and substrates

    • Review experimental procedures for inconsistencies in execution

  • Critical parameters assessment:

    • Reassess enzyme purity and potential presence of inhibitory contaminants

    • Evaluate the impact of buffer conditions (pH, ionic strength) on enzyme activity

    • Consider substrate purity and potential degradation

    • Check for equipment calibration issues that might affect measurements

  • Alternative explanations exploration:

    • Consider allosteric regulation mechanisms that might cause non-Michaelis-Menten kinetics

    • Evaluate potential product inhibition effects

    • Assess the possibility of substrate inhibition at high concentrations

    • Investigate the presence of multiple enzyme isoforms with different kinetic properties

  • Modified experimental approaches:

    • Implement alternative assay methods to validate findings

    • Use different detection techniques to eliminate method-specific artifacts

    • Study enzyme kinetics under varying conditions to identify pattern-dependent variables

    • Consider advanced kinetic models beyond simple Michaelis-Menten kinetics

When facing discrepancies, remember that unexpected data often leads to new discoveries. For example, non-linear Lineweaver-Burk plots might indicate cooperative binding or multiple catalytic sites rather than experimental error .

What phenotypic variations should I expect when studying recombinant PlsY in Pseudomonas aeruginosa isolates?

When studying recombinant PlsY in P. aeruginosa isolates, expect significant phenotypic variations even among morphologically identical isolates:

  • Growth and metabolic variations:

    • Growth rate differentials in various media compositions

    • Varying lipid profiles and membrane compositions

    • Different metabolic pathway utilization patterns

    • Varied responses to environmental stressors

  • Enzyme activity differences:

    • Variable enzyme expression levels despite identical promoters

    • Differences in specific activity and substrate affinities

    • Post-translational modifications affecting enzyme function

    • Altered regulatory responses to cellular conditions

  • Virulence factor expression:

    • Significant variations in virulence factor production

    • Trade-offs between growth optimization and virulence

    • Differential quorum sensing signal production and response

    • Varied biofilm formation capabilities

  • Antibiotic susceptibility patterns:

    • Heterogeneous resistance profiles among isolates

    • Enhanced resistance when multiple isolates are combined

    • Variable responses to combination therapies

    • Different adaptation rates under antibiotic pressure

Research has demonstrated that P. aeruginosa isolates from even a single patient sample can exhibit extensive phenotypic diversity, with phenotypic differences statistically associated with distinct recombination events rather than mutations in known genes . This inherent variability must be accounted for in experimental design by:

  • Including multiple isolates in studies

  • Characterizing baseline phenotypic properties

  • Using proper statistical approaches for heterogeneous populations

  • Considering mixed population effects

How can I optimize expression conditions for maximum yield and activity of recombinant PlsY?

Optimizing expression conditions for maximum yield and activity of recombinant PlsY requires systematic evaluation of multiple variables:

  • Expression system selection:

    • Bacterial systems: Modified P. aeruginosa strains may provide better folding compared to E. coli

    • Cell-free systems: Consider for potentially toxic membrane proteins

    • Yeast or insect cell systems: For complex eukaryotic-like post-translational modifications

  • Expression construct optimization:

    • Fusion tags: Compare His6, GST, MBP for solubility enhancement

    • Codon optimization: Adjust for expression host preference

    • Signal sequences: Test periplasmic vs. cytoplasmic targeting

    • Promoter strength: Balance expression rate with folding capacity

  • Culture condition optimization:

    • Temperature: Lower temperatures (16-25°C) often improve folding

    • Induction timing: Typically at mid-log phase (OD600 0.6-0.8)

    • Inducer concentration: Titrate to balance expression and toxicity

    • Media composition: Rich vs. minimal media, supplementation with specific cofactors

  • Protein extraction and purification:

    • Membrane extraction methods: Detergent selection critical for membrane proteins

    • Buffer composition: Optimize pH, salt concentration, and stabilizing additives

    • Chromatography sequence: Typically affinity followed by size exclusion

    • Storage conditions: Glycerol percentage, temperature, and stabilizing additives

Table 2: Optimization Strategy for Recombinant PlsY Expression

ParameterVariables to TestAssessment MethodExpected Impact
Expression temperature16°C, 25°C, 30°C, 37°CSDS-PAGE, Western blotLower temperatures may increase soluble fraction
Induction timeEarly, mid, late log phaseGrowth curves, yield quantificationBalance biomass and expression toxicity
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMExpression level, solubilityHigher isn't always better; optimize for folding
Detergent screeningDDM, LDAO, OG, Triton X-100Enzyme activity assaysCritical for maintaining native conformation

Success in recombinant PlsY production requires an iterative optimization approach, as the ideal conditions may vary based on the specific strain of P. aeruginosa and the expression system used .

How can recombinant PlsY be utilized in developing novel antimicrobial strategies against Pseudomonas aeruginosa?

Recombinant PlsY offers multiple avenues for developing novel antimicrobial strategies against P. aeruginosa:

  • Small molecule inhibitor development:

    • High-throughput screening using recombinant enzyme

    • Structure-based drug design targeting the active site

    • Allosteric inhibitors affecting enzyme regulation

    • Covalent inhibitors for irreversible inactivation

  • Immunological approaches:

    • Recombinant PlsY as a vaccine component

    • Antibody development targeting surface-exposed regions

    • T-cell epitope identification for cellular immunity

    • Combination with outer membrane vesicles (OMVs) for enhanced immunogenicity

  • Combination therapy design:

    • PlsY inhibitors with conventional antibiotics

    • Dual-target inhibitors affecting multiple pathways

    • Membrane-disrupting agents with PlsY inhibitors

    • Biofilm-disrupting agents combined with PlsY inhibitors

  • Resistance mitigation strategies:

    • Target conserved regions with high fitness costs for mutation

    • Multi-target approaches to reduce resistance development

    • Population-level approaches considering mixed bacterial populations

    • Cycling strategies for different inhibitor classes

The development of inhibitors mimicking the transition state of the acylation reaction catalyzed by PlsY, such as those with a negatively charged group, a long saturated chain, and a sulfonamide linker, shows particular promise . Additionally, combining these approaches with strategies targeting other aspects of P. aeruginosa virulence could enhance efficacy, particularly against biofilm-mediated infections.

What are the current methodological challenges in studying PlsY activity in different Pseudomonas aeruginosa strains?

Studying PlsY activity across different P. aeruginosa strains presents several methodological challenges:

  • Genetic diversity management:

    • High levels of intra-isolate diversity (5-64 SNPs) even within single patient samples

    • Recombination as the dominant driver of diversity rather than spontaneous mutation

    • Phenotypic differences not always linked to known genetic changes

    • Need for whole genome analysis to capture full diversity

  • Activity assay standardization:

    • Membrane-bound nature complicates traditional enzyme assays

    • Different extraction methods yield varying activity profiles

    • Substrate accessibility issues in different preparations

    • Background activity from related enzymes

  • In vivo relevance assessment:

    • Laboratory conditions vs. infection environment differences

    • Adapting assays to mimic CF lung conditions

    • Accounting for host factors affecting enzyme function

    • Translating in vitro findings to in vivo significance

  • Technical considerations:

    • Requirement for radioactive substrates in traditional assays

    • Limited availability of specific inhibitors for control experiments

    • Challenges in maintaining enzyme stability during purification

    • Difficulties in comparative quantification across strains

To address these challenges, researchers should consider:

  • Implementing multiple isolate testing from single sources

  • Developing non-radioactive high-throughput assays

  • Using whole genome sequencing to correlate activity with genetic markers

  • Employing advanced statistical methods appropriate for heterogeneous populations

How might environmental factors affect PlsY expression and function in Pseudomonas aeruginosa biofilms?

Environmental factors significantly influence PlsY expression and function in P. aeruginosa biofilms through complex regulatory networks:

  • Oxygen availability effects:

    • Oxygen gradients within biofilms create heterogeneous microenvironments

    • Anaerobic conditions alter lipid metabolism pathways

    • Oxygen limitation may trigger alternative regulatory mechanisms for PlsY

    • Adaptation to low oxygen often increases antibiotic tolerance

  • Nutrient availability impact:

    • Carbon source availability affects lipid precursor pools

    • Iron limitation alters membrane composition and PlsY regulation

    • Phosphate limitation affects phospholipid synthesis pathways

    • Nutrient gradients create metabolically diverse subpopulations within biofilms

  • Quorum sensing interactions:

    • QS signals showing large variances among isolates affect collective behaviors

    • Population density sensing regulates membrane composition

    • QS-controlled virulence factors may indirectly affect PlsY function

    • Trade-offs between growth optimization and QS signal production

  • Stress response mechanisms:

    • Antibiotic exposure triggers membrane remodeling requiring PlsY activity

    • pH fluctuations alter membrane properties and enzyme function

    • Immune effector molecules induce adaptive responses

    • Oxidative stress affects lipid metabolism and membrane integrity

The phenotypic diversity observed in P. aeruginosa populations, even in morphologically identical isolates, suggests that environmental adaptation involves significant alterations in metabolic pathways, including those involving PlsY . This diversity, driven by recombination events, enables the bacterial population to optimize survival in the heterogeneous microenvironments present in biofilms.

To accurately study these effects, research approaches should include:

  • Biofilm growth systems that maintain environmental gradients

  • Single-cell analysis techniques to capture population heterogeneity

  • Transcriptomic and proteomic analyses under varied conditions

  • In situ enzyme activity measurements within intact biofilms

What are common issues in recombinant PlsY purification and how can they be resolved?

Recombinant PlsY purification presents several challenges due to its membrane-associated nature. Here are common issues and their solutions:

  • Low expression yields:

    • Issue: Toxicity of overexpressed membrane protein

    • Solution: Use tightly controlled expression systems, lower induction temperatures (16-20°C), and consider specialized expression strains

    • Issue: Protein misfolding and aggregation

    • Solution: Co-express molecular chaperones, use fusion partners that enhance solubility (MBP, SUMO), optimize codon usage

  • Poor solubilization:

    • Issue: Inefficient extraction from membranes

    • Solution: Screen multiple detergents (DDM, LDAO, OG) at various concentrations; consider novel solubilization strategies like SMALPs (styrene-maleic acid lipid particles)

    • Issue: Loss of enzyme activity during solubilization

    • Solution: Include stabilizing agents (glycerol 10-20%, specific lipids), maintain low temperatures throughout, minimize exposure to air

  • Purification complications:

    • Issue: Co-purification of contaminating proteins

    • Solution: Implement multiple chromatography steps (ion exchange following affinity), consider on-column washing with low concentrations of secondary detergents

    • Issue: Tag cleavage inefficiency

    • Solution: Optimize protease conditions, test different cleavage sites, consider leaving the tag if it doesn't interfere with activity

  • Stability problems:

    • Issue: Activity loss during storage

    • Solution: Test various buffer compositions, add stabilizing agents (glycerol, specific lipids), flash-freeze in small aliquots, avoid freeze-thaw cycles

    • Issue: Aggregation during concentration

    • Solution: Use gentle concentration methods, maintain detergent above critical micelle concentration, consider binding to affinity resin with subsequent elution at desired concentration

Table 3: Troubleshooting Guide for PlsY Purification

ProblemPossible CauseDiagnostic TestSolution
Low yieldToxicity to expression hostGrowth curve analysis with/without inductionLower induction temperature, reduce inducer concentration
No activityImproper foldingCircular dichroism spectroscopyTry different detergents, add specific lipids
Multiple bands on SDS-PAGEProteolytic degradationWestern blot with tag-specific antibodyAdd protease inhibitors, reduce purification time
Precipitation after purificationDetergent removal or exchangeDynamic light scatteringMaintain detergent above CMC, gradual detergent exchange

How can I address inconsistent results when comparing PlsY activity across different experimental setups?

Addressing inconsistent results when comparing PlsY activity across different experimental setups requires systematic troubleshooting:

  • Standardization of enzyme source:

    • Issue: Variations in expression systems and purification methods

    • Solution: Standardize expression constructs, host strains, and purification protocols; alternatively, use the same enzyme batch for comparative studies

    • Issue: Different storage conditions affecting enzyme stability

    • Solution: Establish and strictly follow standardized storage protocols; perform activity checks before experiments

  • Assay condition variables:

    • Issue: Different buffer compositions affecting enzyme kinetics

    • Solution: Perform buffer optimization studies and use identical buffers across experiments; consider the impact of minor components (e.g., divalent cations)

    • Issue: Temperature and pH fluctuations

    • Solution: Use temperature-controlled equipment, prepare fresh buffers, verify pH before each experiment

  • Substrate preparation differences:

    • Issue: Variation in substrate quality or preparation methods

    • Solution: Use single lots of substrates when possible; standardize preparation methods with quality control checks

    • Issue: Substrate degradation over time

    • Solution: Prepare fresh substrates or aliquot and store appropriately; include substrate stability controls

  • Detection method variations:

    • Issue: Different detection platforms or methodologies

    • Solution: Validate new methods against established ones; include internal standards and reference compounds

    • Issue: Instrument calibration differences

    • Solution: Regular calibration checks; include standard curves with each experiment

When facing contradictory data, it's essential to examine the data thoroughly, evaluate initial assumptions, consider alternative explanations, modify data collection processes if necessary, and refine variables with additional controls . This systematic approach helps identify whether inconsistencies stem from genuine biological variation or technical factors.

What strategies can help overcome the challenges of studying PlsY in antibiotic resistance development?

Investigating PlsY's role in antibiotic resistance development presents unique challenges that require specialized approaches:

  • Heterogeneity management:

    • Challenge: P. aeruginosa populations show high phenotypic diversity even when morphologically identical

    • Strategy: Analyze multiple single isolates (>20) from clinical samples; develop methods for studying mixed populations; use statistical approaches appropriate for heterogeneous populations

    • Challenge: Resistance significantly increases when multiple isolates are mixed together

    • Strategy: Compare single isolate vs. mixed population responses; develop models that predict emergent resistance from individual isolate properties

  • Temporal dynamics assessment:

    • Challenge: Resistance development occurs over time with complex adaptation patterns

    • Strategy: Implement longitudinal sampling designs; use continuous culture systems to monitor adaptation; develop methods to track subpopulation dynamics

    • Challenge: Laboratory evolution may differ from in vivo adaptation

    • Strategy: Compare clinical isolates collected over treatment courses; develop model systems that better mimic in vivo conditions

  • Mechanistic elucidation:

    • Challenge: Multiple resistance mechanisms operate simultaneously

    • Strategy: Employ systems biology approaches combining transcriptomics, proteomics, and metabolomics; develop targeted mutagenesis to isolate specific mechanisms

    • Challenge: Distinguishing PlsY-specific effects from general membrane adaptations

    • Strategy: Create specific PlsY variants with altered function but maintained structure; use comparative genomics across resistant isolates to identify PlsY-associated mutations

  • Translational relevance enhancement:

    • Challenge: In vitro findings may not predict clinical outcomes

    • Strategy: Validate laboratory findings using ex vivo clinical samples; develop animal models that recapitulate human infection conditions

    • Challenge: Traditional susceptibility testing may not capture resistance mechanisms

    • Strategy: Develop alternative testing approaches that account for physiological adaptation and population heterogeneity

The complex relationship between recombination, phenotypic diversity, and antibiotic resistance in P. aeruginosa highlights the need for refined approaches to antibiotic susceptibility testing in clinical samples, particularly for chronic infections like those in CF patients . Research strategies should account for both genetic mechanisms and non-genetic adaptations that contribute to resistance.

What are the most promising future directions for Pseudomonas aeruginosa PlsY research?

The field of P. aeruginosa PlsY research presents several promising avenues for future investigation:

  • Structural and functional characterization:

    • High-resolution structural studies using cryo-electron microscopy

    • Detailed enzyme kinetics with a range of substrate analogues

    • Identification of regulatory mechanisms controlling PlsY activity

    • Elucidation of protein-protein interactions affecting function

  • Therapeutic development:

    • Novel inhibitor scaffolds based on transition state mimics

    • Combination approaches targeting PlsY and complementary pathways

    • Membrane-active antimicrobials with enhanced activity against PlsY-compromised bacteria

    • Immunological approaches using recombinant PlsY-derived antigens

  • Resistance mechanism understanding:

    • Population-level studies examining heterogeneity in PlsY function

    • Impact of recombination on PlsY gene variants and expression

    • Role of PlsY in membrane adaptation to antibiotics

    • Systems biology approaches to place PlsY in broader resistance networks

  • Clinical applications:

    • Development of diagnostic tools based on PlsY function or expression

    • Personalized treatment approaches based on PlsY variants

    • Biomarker applications for monitoring treatment efficacy

    • Novel formulations to enhance penetration of PlsY-targeting compounds through biofilms

The integration of computational approaches, high-throughput screening methodologies, and advanced structural biology techniques offers particularly promising opportunities for accelerating progress in these areas . Additionally, the development of more sophisticated models of P. aeruginosa infection that better mimic the complex environments encountered in human hosts will be crucial for translating fundamental research into clinical applications.

How can researchers effectively manage and integrate diverse data types when studying PlsY in Pseudomonas aeruginosa?

Effectively managing and integrating diverse data types in PlsY research requires a comprehensive data integration strategy:

  • Standardized data collection and storage:

    • Implement consistent metadata annotation across experiments

    • Establish standardized formats for different data types

    • Utilize electronic laboratory notebooks with structured templates

    • Develop data repositories with appropriate access controls

  • Multi-omics data integration approaches:

    • Correlation analyses across genomic, transcriptomic, proteomic, and metabolomic datasets

    • Network biology approaches to identify functional relationships

    • Machine learning algorithms for pattern recognition across diverse data types

    • Pathway-based analyses to place PlsY in broader biological context

  • Visualization and interpretation tools:

    • Interactive visualization platforms for complex datasets

    • Statistical frameworks appropriate for heterogeneous data

    • Bayesian approaches for integrating data of varying quality

    • Collaborative platforms for multidisciplinary interpretation

  • Translational data bridges:

    • Methods to connect basic research findings with clinical observations

    • Frameworks for relating in vitro, animal model, and human data

    • Approaches for integrating laboratory and point-of-care measurements

    • Systems for relating phenotypic observations to molecular mechanisms

When facing contradictory data across different experimental systems, researchers should examine the data thoroughly, evaluate initial assumptions, consider alternative explanations, and refine variables with additional controls . This systematic approach helps identify whether inconsistencies stem from genuine biological variation or technical factors.

What interdisciplinary approaches might advance our understanding of PlsY's role in Pseudomonas aeruginosa pathogenesis?

Advancing our understanding of PlsY's role in P. aeruginosa pathogenesis will benefit from interdisciplinary approaches that bridge multiple scientific domains:

  • Structural biology and biophysics integration:

    • Advanced imaging techniques (cryo-EM, super-resolution microscopy)

    • Biophysical methods to study membrane protein dynamics

    • Computational modeling of enzyme-membrane interactions

    • Single-molecule approaches to study enzyme kinetics

  • Systems biology and computational approaches:

    • Network analysis of lipid metabolism in the context of virulence

    • Flux balance analysis to identify metabolic vulnerabilities

    • Machine learning for biomarker identification

    • Predictive modeling of resistance development

  • Clinical microbiology and immunology synergy:

    • Studies of host-pathogen interactions focused on membrane remodeling

    • Immune response to membrane components during infection

    • Population dynamics of P. aeruginosa during clinical infections

    • Development of diagnostic approaches based on membrane phenotypes

  • Chemical biology and pharmacology collaboration:

    • Development of chemical probes for PlsY function studies

    • Drug delivery strategies for targeting bacterial membranes

    • Combination therapy approaches based on membrane vulnerability

    • Structure-based drug design informed by biological insights

The successful integration of these approaches requires collaborative research teams with expertise spanning multiple disciplines. Particularly promising is the combination of advanced computational methodologies with experimental approaches, as exemplified by workflows developed for other recombinant proteins , adapted to address the specific challenges of membrane-associated enzymes like PlsY.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.